E3 ubiquitin-protein ligase TRIM21 (Trim21) Recombinant Protein | Trim21 recombinant protein
Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 (Trim21)
Gene Names
Trim21; Ro52; Ssa1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase TRIM21 (Trim21); N/A; Recombinant Mouse E3 ubiquitin-protein ligase TRIM21 (Trim21); 52 kDa Ro protein; 52 kDa ribonucleoprotein autoantigen Ro/SS-A; Ro(SS-A); Sjoegren syndrome type A antigen; SS-A; Tripartite motif-containing protein 21; Trim21 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-470aa; Full Length
Sequence
MSPSTTSKMSLEKMWEEVTCSICLDPMVEPMSIECGHCFCKECIFEVGKNGGSSCPECRQQFLLRNLRPNRHIANMVENLKQIAQNTKKSTQETHCMKHGEKLHLFCEEDGQALCWVCAQSGKHRDHTRVPIEEAAKVYQEKIHVVLEKLRKGKELAEKMEMDLTMQRTDWKRNIDTQKSRIHAEFALQNSLLAQEEQRQLQRLEKDQREYLRLLGKKEAELAEKNQALQELISELERRIRGSELELLQEVRIILERSGSWNLDTLDIDAPDLTSTCPVPGRKKMLRTCWVHITLDRNTANSWLIISKDRRQVRMGDTHQNVSDNKERFSNYPMVLGAQRFSSGKMYWEVDVTQKEAWDLGVCRDSVQRKGQFSLSPENGFWTIWLWQDSYEAGTSPQTTLHIQVPPCQIGIFVDYEAGVVSFYNITDHGSLIYTFSECVFAGPLRPFFNVGFNYSGGNAAPLKLCPLKM
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for Trim21 recombinant protein
E3 ubiquitin-protein ligase whose activity is dependent on E2 enzymes, UBE2D1, UBE2D2, UBE2E1 and UBE2E2. Forms a ubiquitin ligase complex in cooperation with the E2 UBE2D2 that is used not only for the ubiquitination of USP4 and IKBKB but also for its self-ubiquitination. Component of cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes such as SCF(SKP2)-like complexes. A TRIM21-containing SCF(SKP2)-like complex is shown to mediate ubiquitination of CDKN1B ('Thr-187' phosphorylated-form), thereby promoting its degradation by the proteasome. Monoubiquitinates IKBKB that will negatively regulates Tax-induced NF-kappa-B signaling. Negatively regulates IFN-beta production post-pathogen recognition by polyubiquitin-mediated degradation of IRF3. Mediates the ubiquitin-mediated proteasomal degradation of IgG1 heavy chain, which is linked to the VCP-mediated ER-associated degradation (ERAD) pathway. Promotes IRF8 ubiquitination, which enhanced the ability of IRF8 to stimulate cytokine genes transcription in macrophages. Plays a role in the regulation of the cell cycle progression. Enhances the decapping activity of DCP2. Exists as a ribonucleoprotein particle present in all mammalian cells studied and composed of a single polypeptide and one of four small RNA molecules. At least two isoforms are present in nucleated and red blood cells, and tissue specific differences in RO/SSA proteins have been identified. The common feature of these proteins is their ability to bind HY RNAs. 2.
References
Structural differences between the human and mouse 52-kD Ro autoantigens associated with poorly conserved autoantibody activity across species.Keech C.L., Gordon T.P., McCluskey J.Clin. Exp. Immunol. 104:255-263(1996)
Autoantigen Ro52 is an interferon inducible E3 ligase that ubiquitinates IRF-8 and enhances cytokine expression in macrophages.Kong H.J., Anderson D.E., Lee C.H., Jang M.K., Tamura T., Tailor P., Cho H.K., Cheong J., Xiong H., Morse H.C. III, Ozato K.J. Immunol. 179:26-30(2007)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
70.2 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRIM21
NCBI Official Synonym Full Names
tripartite motif-containing 21
NCBI Official Symbol
Trim21
NCBI Official Synonym Symbols
Ro52; Ssa1
NCBI Protein Information
E3 ubiquitin-protein ligase TRIM21
UniProt Protein Name
E3 ubiquitin-protein ligase TRIM21
UniProt Gene Name
Trim21
UniProt Synonym Gene Names
Ro52; Ssa1; SS-A
UniProt Entry Name
RO52_MOUSE
Similar Products
Product Notes
The Trim21 trim21 (Catalog #AAA18746) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-470aa; Full Length. The amino acid sequence is listed below: MSPSTTSKMS LEKMWEEVTC SICLDPMVEP MSIECGHCFC KECIFEVGKN GGSSCPECRQ QFLLRNLRPN RHIANMVENL KQIAQNTKKS TQETHCMKHG EKLHLFCEED GQALCWVCAQ SGKHRDHTRV PIEEAAKVYQ EKIHVVLEKL RKGKELAEKM EMDLTMQRTD WKRNIDTQKS RIHAEFALQN SLLAQEEQRQ LQRLEKDQRE YLRLLGKKEA ELAEKNQALQ ELISELERRI RGSELELLQE VRIILERSGS WNLDTLDIDA PDLTSTCPVP GRKKMLRTCW VHITLDRNTA NSWLIISKDR RQVRMGDTHQ NVSDNKERFS NYPMVLGAQR FSSGKMYWEV DVTQKEAWDL GVCRDSVQRK GQFSLSPENG FWTIWLWQDS YEAGTSPQTT LHIQVPPCQI GIFVDYEAGV VSFYNITDHG SLIYTFSECV FAGPLRPFFN VGFNYSGGNA APLKLCPLKM . It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase TRIM21 (Trim21), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
