933W Shiga-like toxin 2 subunit B Recombinant Protein | stxB2 recombinant protein
Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)
Gene Names
stxB2; L0104; sltIIB; stx2B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
933W Shiga-like toxin 2 subunit B; N/A; Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2); Verocytotoxin 2 subunit B; Verotoxin 2 subunit B; stxB2 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-89aa; Full Length of Mature Protein
Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Production Note
Special Offer: The E Coli, Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Coli, Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli, Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli, Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for stxB2 recombinant protein
The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
References
Nucleotide sequence analysis and comparison of the structural genes for Shiga-like toxin I and Shiga-like toxin II encoded by bacteriophages from Escherichia coli 933.Jackson M.P., Neill R.J., O'Brien A.D., Holmes R.K., Newland J.W.FEMS Microbiol. Lett. 44:109-114(1987) An ileX tRNA gene is located close to the Shiga toxin II operon in enterohemorrhagic Escherichia coli O157 and non-O157 strains.Schmidt H., Scheef J., Janetzki-Mittmann C., Datz M., Karch H.FEMS Microbiol. Lett. 149:39-44(1997) Sequence of Shiga toxin 2 phage 933W from Escherichia coli O157:H7 Shiga toxin as a phage late-gene product.Plunkett G. III, Rose D.J., Durfee T.J., Blattner F.R.J. Bacteriol. 181:1767-1778(1999) Identification of three amino acid residues in the B subunit of Shiga toxin and Shiga-like toxin type II that are essential for holotoxin activity.Perera L.P., Samuel J.E., Holmes R.K., O'Brien A.D.J. Bacteriol. 173:1151-1160(1991) Structure of shiga toxin type 2 (Stx2) from Escherichia coli O157:H7.Fraser M.E., Fujinaga M., Cherney M.M., Melton-Celsa A.R., Twiddy E.M., O'Brien A.D., James M.N.G.J. Biol. Chem. 279:27511-27517(2004) Binding of adenine to Stx2, the protein toxin from Escherichia coli O157:H7.Fraser M.E., Cherney M.M., Marcato P., Mulvey G.L., Armstrong G.D., James M.N.Acta Crystallogr. F 62:627-630(2006)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23.8 kDa
NCBI Official Full Name
Shiga toxin 2 subunit B
NCBI Official Symbol
stxB2
NCBI Official Synonym Symbols
L0104; sltIIB; stx2B
NCBI Protein Information
Shiga toxin 2 subunit B
UniProt Protein Name
Shiga-like toxin 2 subunit B
UniProt Gene Name
stxB2
UniProt Synonym Gene Names
stx2B; SLT-2 B subunit; SLT-2b; SLT-IIb; Verotoxin 2 subunit B
UniProt Entry Name
STXB_BP933
Similar Products
Product Notes
The stxB2 stxb2 (Catalog #AAA115047) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-89aa; Full Length of Mature Protein. The amino acid sequence is listed below: ADCAKGKIEF SKYNEDDTFT VKVDGKEYWT SRWNLQPLLQ SAQLTGMTVT IKSSTCESGS GFAEVQFNND. It is sometimes possible for the material contained within the vial of "933W Shiga-like toxin 2 subunit B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
