Shiga-Like Toxin 1 Subunit B (stxB) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
H19B Shiga-like toxin 1 subunit B; N/A; Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B; Verocytotoxin 1 subunit B; Verotoxin 1 subunit B; stxB recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
21-89aa; Full Length of Mature Protein
Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for stxB recombinant protein
The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.
References
Nucleotide sequence of the Shiga-like toxin genes of Escherichia coli.Calderwood S.B., Auclair F., Donohue-Rolfe A., Keusch G.T., Mekalanos J.J.Proc. Natl. Acad. Sci. U.S.A. 84:4364-4368(1987) Nucleotide sequence and promoter mapping of the Escherichia coli Shiga-like toxin operon of bacteriophage H-19B.de Grandis S., Ginsberg J., Toone M., Climie S., Friesen J., Brunton J.L.J. Bacteriol. 169:4313-4319(1987) Phenylalanine 30 plays an important role in receptor binding of verotoxin-1.Clark C., Bast D.J., Sharp A.M., St Hilaire P.M., Agha R., Stein P.E., Toone E.J., Read R.J., Brunton J.L.Mol. Microbiol. 19:891-899(1996) The identification of three biologically relevant globotriaosyl ceramide receptor binding sites on the Verotoxin 1 B subunit.Bast D.J., Banerjee L., Clark C., Read R.J., Brunton J.L.Mol. Microbiol. 32:953-960(1999) Crystal structure of the cell-binding B oligomer of verotoxin-1 from E. coli.Stein P.E., Boodhoo A., Tyrrell G.J., Brunton J.L., Read R.J.Nature 355:748-750(1992) Solution structure of the carbohydrate-binding B-subunit homopentamer of verotoxin VT-1 from E. coli.Richardson J.M., Evans P.D., Homans S.W., Donohue-Rolfe A.Nat. Struct. Biol. 4:190-193(1997) Structure of the shiga-like toxin I B-pentamer complexed with an analogue of its receptor Gb3.Ling H., Boodhoo A., Hazes B., Cummings M.D., Armstrong G.D., Brunton J.L., Read R.J.Biochemistry 37:1777-1788(1998) Shiga-like toxins are neutralized by tailored multivalent carbohydrate ligands.Kitov P.I., Sadowska J.M., Mulvey G., Armstrong G.D., Ling H., Pannu N.S., Read R.J., Bundle D.R.Nature 403:669-672(2000)
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
23.7 kDa
NCBI Official Full Name
Shiga-like toxin 1 subunit B
UniProt Protein Name
Shiga-like toxin 1 subunit B
UniProt Gene Name
stxB
UniProt Synonym Gene Names
sltB; SLT-1 B subunit; SLT-1b; SLT-Ib; Verotoxin 1 subunit B
UniProt Entry Name
STXB_BPH19
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The stxB stxb (Catalog #AAA115361) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-89aa; Full Length of Mature Protein. The amino acid sequence is listed below: TPDCVTGKVE YTKYNDDDTF TVKVGDKELF TNRWNLQSLL LSAQITGMTV TIKTNACHNG GGFSEVIFR. It is sometimes possible for the material contained within the vial of "H19B Shiga-like toxin 1 subunit B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
