Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA27034_SDS_PAGE.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Coronavirus OC43 Spike Glycoprotein (S) Recombinant Protein | S recombinant protein

Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Coronavirus OC43 Spike Glycoprotein (S); N/A; Recombinant Human coronavirus OC43 Spike glycoprotein (S), partial; S; 3; Spike glycoprotein; S glycoprotein; E2; Peplomer protein) [Cleaved into: Spike protein S1; Spike protein S2; Spike protein S2']; S recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
15-344. Partial
Sequence
VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK
Species
Human coronavirus OC43 (HCoV-OC43)
Subcellular Location
Spike protein S2: Virion membrane; Single-pass type I membrane protein; Host endoplasmic reticulum-Golgi intermediate compartment membrane; Single-pass type I membrane protein; Note=Accumulates in the endoplasmic reticulum-Golgi intermediate compartment; where it participates in virus particle assembly; Some S oligomers may be transported to the plasma membrane; where they may mediate cell-cell fusion (By similarity); SUBCELLULAR LOCATION: Spike protein S1: Virion membrane; Peripheral membrane protein; Host endoplasmic reticulum-Golgi intermediate compartment membrane; Peripheral membrane protein
Protein Families
Betacoronaviruses spike protein family
Buffer
"If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

product-image-AAA27034_SDS_PAGE.jpg SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for S recombinant protein
S1 attaches the virion to the cell membrane by interacting with sialic acid-containing cell receptors, initiating the infection.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
53.6 kDa
UniProt Protein Name
Spike glycoprotein
UniProt Gene Name
S
UniProt Synonym Gene Names
S glycoprotein
UniProt Entry Name
SPIKE_CVHOC

Similar Products

Product Notes

The Coronavirus OC43 Spike Glycoprotein (S) s (Catalog #AAA27034) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 15-344. Partial. The amino acid sequence is listed below: VIGDLKCTSD NINDKDTGPP PISTDTVDVT NGLGTYYVLD RVYLNTTLFL NGYYPTSGST YRNMALKGSV LLSRLWFKPP FLSDFINGIF AKVKNTKVIK DRVMYSEFPA ITIGSTFVNT SYSVVVQPRT INSTQDGDNK LQGLLEVSVC QYNMCEYPQT ICHPNLGNHR KELWHLDTGV VSCLYKRNFT YDVNADYLYF HFYQEGGTFY AYFTDTGVVT KFLFNVYLGM ALSHYYVMPL TCNSKLTLEY WVTPLTSRQY LLAFNQDGII FNAEDCMSDF MSEIKCKTQS IAPPTGVYEL NGYTVQPIAD VYRRKPNLPN CNIEAWLNDK . It is sometimes possible for the material contained within the vial of "Coronavirus OC43 Spike Glycoprotein (S), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.