Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mammalian Cell S1-RBD Active Protein – Cat# AAA244032 – Bioactivity Bioactivity

Spike Glycoprotein (S) (S1-RBD) Mammalian Cell Active Protein

Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Spike glycoprotein (S); N/A; Recombinant Human Novel Coronavirus Spike glycoprotein (S), partial; Spike glycoprotein; S1-RBD active protein
Ordering

Product Overview

Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH8.0
Lyophilized or liquid (Format to be determined during the manufa
Sequence Positions
319-541aa (V367F), Partial
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSFLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Species
SARS-CoV-2
Endotoxin
Less than 1.0EU/ug as determined by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (V367F) at 5ug/ml can bind human ACE2, the EC50 is 65.58-90.16ng/ml.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C.
Store working aliquots at 4 degrees C for up to one week.
Repeated freezing and thawing is not recommended.

Bioactivity

Mammalian Cell S1-RBD Active Protein – Cat# AAA244032 – Bioactivity Bioactivity

SDS-PAGE

((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)

Mammalian Cell S1-RBD Active Protein – Cat# AAA244032 – SDS-PAGE SDS-PAGE ((Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.)
Related Product Information for S1-RBD active protein
The cDNA fragment encoding 319-541AA of the V367Fmatation of human SARS-CoV-2 spike glycoprotein (S) was fused with a C-terminal 10xHis-tag and then expressed in the mammalian cell. The product is the recombinant partial-length SARS-CoV-2-S protein. Its purity was measured by using SDS-PAGE and reached up to 90%. Under reducing conditions, there presented a molecular mass band of about 35 kDa on the gel. The slightly higher result was attributed to glycosylation. It contains less than 1.0 EU/ug determined by the LAL method. It is also identified as an active protein through the functional ELISA. This recombinant SARS-CoV-2-S protein is in-stock now.

NCBI and Uniprot Product Information

UniProt Accession #
Molecular Weight
30.1kDa

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The S1-RBD (Catalog #AAA244032) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 319-541aa (V367F), Partial. The amino acid sequence is listed below: RVQPTESIVR FPNITNLCPF GEVFNATRFA SVYAWNRKRI SNCVADYSFL YNSASFSTFK CYGVSPTKLN DLCFTNVYAD SFVIRGDEVR QIAPGQTGKI ADYNYKLPDD FTGCVIAWNS NNLDSKVGGN YNYLYRLFRK SNLKPFERDI STEIYQAGST PCNGVEGFNC YFPLQSYGFQ PTNGVGYQPY RVVVLSFELL HAPATVCGPK KSTNLVKNKC VNF. It is sometimes possible for the material contained within the vial of "Spike glycoprotein (S), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.