RNA Polymerase II 215Kd Subunit (RPII215) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Drosophila melanogaster DNA-directed RNA polymerase II subunit RPB1
Gene Names
RpII215; 5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmelCG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[s
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
DNA-directed RNA polymerase II subunit RPB1; N/A; Recombinant Drosophila melanogaster DNA-directed RNA polymerase II subunit RPB1; DNA-directed RNA polymerase III largest subunit; RpII215 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1579-1881
Sequence
YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPT
Sequence Length
1887
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for RpII215 recombinant protein
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing
References
"Analysis of the gene encoding the largest subunit of RNA polymerase II in Drosophila." Jokerst R.S., Weeks J.R., Zehring W.A., Greenleaf A.L. Mol. Gen. Genet. 215:266-275(1989)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
33.6 kDa
NCBI Official Full Name
RNA polymerase II 215kD subunit
NCBI Official Synonym Full Names
RNA polymerase II 215kD subunit
NCBI Official Symbol
RpII215
NCBI Official Synonym Symbols
5; 8WG16; alphaPol IIo[ser2]; CG1554; CTD; DmelCG1554; dRpb1; dRPB1; H5; II; IIo; l(1)10Ca; l(1)DC912; l(1)DF912; l(1)G0040; l(1)L5; L5; POL; pol II; Pol II; Pol II CTD; Pol II Ser5p; Pol II Ser5P; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[s
NCBI Protein Information
CG1554 gene product from transcript CG1554-RA
UniProt Protein Name
DNA-directed RNA polymerase II subunit RPB1
UniProt Gene Name
RpII215
UniProt Synonym Gene Names
RNA polymerase II subunit B1
UniProt Entry Name
RPB1_DROME
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The RpII215 rpii215 (Catalog #AAA115759) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1579-1881. The amino acid sequence is listed below: YSPTSPNYTA SSPGGASPNY SPSSPNYSPT SPLYASPRYA STTPNFNPQS TGYSPSSSGY SPTSPVYSPT VQFQSSPSFA GSGSNIYSPG NAYSPSSSNY SPNSPSYSPT SPSYSPSSPS YSPTSPCYSP TSPSYSPTSP NYTPVTPSYS PTSPNYSASP QYSPASPAYS QTGVKYSPTS PTYSPPSPSY DGSPGSPQYT PGSPQYSPAS PKYSPTSPLY SPSSPQHSPS NQYSPTGSTY SATSPRYSPN MSIYSPSSTK YSPTSPTYTP TARNYSPTSP MYSPTAPSHY SPTSPAYSPS SPT. It is sometimes possible for the material contained within the vial of "DNA-directed RNA polymerase II subunit RPB1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
