Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us

Filters


Clonality

Type

Reactivity

Gene Name

Isotype

Host

Application

Clone

Recombinant Proteins

Recombinant proteins are purified laboratory reagents created through genetic engineering for advanced biomedical research, such as immunology, neuroscience, cancer research, and more.


At AAA Biotech, also known as AAA Bio or AAABio, we provide high-quality recombinant proteins. Our various protein products are carefully tested for consistent and reliable performance. With our proteins, we offer stringent quality control, lot-to-lot consistency, and precise specificity to help you achieve accurate results in your research.


Whether you're conducting research on cell expansion, polarization, differentiation, or cell processing, we can offer the exact recombinant proteins you need in order to support your work.


Viewing 3050-3100 of 14163 product results


product-image-AAA114762_SDS_PAGE15.jpg SDS-PAGE

Zinc metalloproteinase adamalysin-2, Recombinant Protein (Cat# AAA114762)

No reviews yet
Full Name
Recombinant Crotalus adamanteus Zinc metalloproteinase adamalysin-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114764_SDS_PAGE15.png SDS-PAGE

Fibroblast growth factor 15 (Fgf15), Recombinant Protein (Cat# AAA114764)

No reviews yet
Full Name
Recombinant Mouse Fibroblast growth factor 15 (Fgf15)
Gene Names
Fgf15; FGF19
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

2,3-diketo-5-methylthiopentyl-1-phosphate enolase (mtnW), Recombinant Protein (Cat# AAA114767)

No reviews yet
Full Name
Recombinant Bacillus pumilus 2,3-diketo-5-methylthiopentyl-1-phosphate enolase (mtnW)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Lymphocyte antigen 6C1 (Ly6c1), Recombinant Protein (Cat# AAA114772)

No reviews yet
Full Name
Recombinant Mouse Lymphocyte antigen 6C1 (Ly6c1)
Gene Names
Ly6c1; Ly6c; Ly-6C; Ly-6C1; AA682074; AA959465
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Phosphodiesterase yfcE (yfcE), Recombinant Protein (Cat# AAA114777)

No reviews yet
Full Name
Recombinant Escherichia coli O6 Phosphodiesterase yfcE (yfcE)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114778_SDS_PAGE15.jpg SDS-PAGE

strain K12 Methyl-accepting chemotaxis protein II, Recombinant Protein (Cat# AAA114778)

No reviews yet
Full Name
Recombinant strain K12 Methyl-accepting chemotaxis protein II
Gene Names
tar; cheM; ECK1887; JW1875
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114788_SEQUENCE15.jpg Sequence (There is an 'X' in the original sequence (amino acid 78), the 'X' refers to any amino acid. The lab usually mutates ‘X’ to S. Thus the mutated sequence manufactured by the lab is QTVQVEPPYYAGDGEYLMVDLIWTQCEPCTQCFSQDSSSFSTLPCESQYCQDLPSETCDCQYTYGYGDGSSTQGYMASEDGSSVPNIAFGCGDN LQIDSGTTLTYLPQDAYNAVAQAFTDQINLPTVDESSSGLSTCFQEPSDGSTVQVPEISMQDGGVLNDLQNLAVSFFPTQCGAS)

Aspartic proteinase nepenthesin-2, Recombinant Protein (Cat# AAA114788)

No reviews yet
Full Name
Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Streptomycin 3'-adenylyltransferase (aadA), Recombinant Protein (Cat# AAA114792)

No reviews yet
Full Name
Recombinant Escherichia coli Streptomycin 3'-adenylyltransferase (aadA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Exo-glucosaminidase lytG (lytG), Recombinant Protein (Cat# AAA114795)

No reviews yet
Full Name
Recombinant Bacillus subtilis Exo-glucosaminidase lytG (lytG)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Matrix M2-1 (M2-1), Recombinant Protein (Cat# AAA114796)

No reviews yet
Full Name
Recombinant Human respiratory syncytial virus B Matrix M2-1 (M2-1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Secreted protein BARF1 (BARF1), Recombinant Protein (Cat# AAA114798)

No reviews yet
Full Name
Recombinant Epstein-Barr virus Secreted protein BARF1 (BARF1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Interleukin-1 receptor-associated kinase-like 2 (IRAK2), Recombinant Protein (Cat# AAA114802)

No reviews yet
Full Name
Recombinant Human Interleukin-1 receptor-associated kinase-like 2 (IRAK2)
Gene Names
IRAK2; IRAK-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Bacteriocin pediocin PA-1 (pedA), Recombinant Protein (Cat# AAA114803)

No reviews yet
Full Name
Recombinant Pediococcus acidilactici Bacteriocin pediocin PA-1 (pedA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Defensin-A1, Recombinant Protein (Cat# AAA114806)

No reviews yet
Full Name
Recombinant Ornithorhynchus anatinus Defensin-A1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Nuclear export protein (NS), Recombinant Protein (Cat# AAA114807)

No reviews yet
Full Name
Recombinant Influenza B virus Nuclear export protein (NS)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Polymerase basic protein 2 (PB2), Recombinant Protein (Cat# AAA114810)

No reviews yet
Full Name
Recombinant Influenza A virus Polymerase basic protein 2 (PB2), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114811_SDS_PAGE15.jpg SDS-PAGE

Envelope glycoprotein B (gB), Recombinant Protein (Cat# AAA114811)

No reviews yet
Full Name
Recombinant Epstein-Barr virus Envelope glycoprotein B (gB), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Flotillin-1 (FLOT1), Recombinant Protein (Cat# AAA114650)

No reviews yet
Full Name
Recombinant Human Flotillin-1 (FLOT1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

60 kDa chaperonin (groL), Recombinant Protein (Cat# AAA114652)

No reviews yet
Full Name
Recombinant Coxiella burnetii 60 kDa chaperonin (groL), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Envelope glycoprotein B (gB), Recombinant Protein (Cat# AAA114656)

No reviews yet
Full Name
Recombinant Human cytomegalovirus Envelope glycoprotein B (gB), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Invasin ipaC (ipaC), Recombinant Protein (Cat# AAA114662)

No reviews yet
Full Name
Recombinant Shigella dysenteriae Invasin ipaC (ipaC)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Acid ceramidase (ASAH1), Recombinant Protein (Cat# AAA114665)

No reviews yet
Full Name
Recombinant Pan troglodytes Acid ceramidase (ASAH1)
Gene Names
ASAH1; AC
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Peptidyl-tRNA hydrolase (pth), Recombinant Protein (Cat# AAA114667)

No reviews yet
Full Name
Recombinant Acidovorax ebreus Peptidyl-tRNA hydrolase (pth)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Matrix protein 1 (M), Recombinant Protein (Cat# AAA114679)

No reviews yet
Full Name
Recombinant Influenza A virus Matrix protein 1 (M)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Beta-tectorin (Tectb), Recombinant Protein (Cat# AAA114680)

No reviews yet
Full Name
Recombinant Mouse Beta-tectorin (Tectb)
Gene Names
Tectb; Tctnb
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114684_SDS_PAGE15.jpg SDS-PAGE

Matrix protein (M), Recombinant Protein (Cat# AAA114684)

No reviews yet
Full Name
Recombinant Rabies virus Matrix protein (M)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Carotenoid 9,10 (9',10')-cleavage dioxygenase 1, Recombinant Protein (Cat# AAA114686)

No reviews yet
Full Name
Recombinant Arabidopsis thaliana Carotenoid 9,10 (9',10')-cleavage dioxygenase 1 , partial
Gene Names
CCD1; D1; ATNCED1; carotenoid cleavage dioxygenase 1; CAROTENOID CLEAVAGE DIOXYGENASE 1; NCED1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114690_AD15.jpg Application Data

Amphiphysin (Amph), Recombinant Protein (Cat# AAA114690)

No reviews yet
Full Name
Recombinant Rat Amphiphysin (Amph)
Gene Names
Amph; Amph1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114691_SDS_PAGE15.jpg SDS-PAGE

Haemolytica Leukotoxin, Recombinant Protein (Cat# AAA114691)

No reviews yet
Full Name
Recombinant Pasteurella haemolytica Leukotoxin(lktA)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Matrix protein 1 (M), Recombinant Protein (Cat# AAA114693)

No reviews yet
Full Name
Recombinant Influenza B virus Matrix protein 1 (M)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114704_SDS_PAGE15.jpg SDS-PAGE

Calreticulin, Recombinant Protein (Cat# AAA114704)

No reviews yet
Full Name
Recombinant Entamoeba histolytica Calreticulin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Outer capsid protein VP4, partial, Recombinant Protein (Cat# AAA114705)

No reviews yet
Full Name
Recombinant Rotavirus A Outer capsid protein VP4, partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Protein phosphatase 1D (PPM1D), Recombinant Protein (Cat# AAA114712)

No reviews yet
Full Name
Recombinant Human Protein phosphatase 1D (PPM1D)
Gene Names
PPM1D; WIP1; IDDGIP; PP2C-DELTA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Intermediate capsid protein VP6, Recombinant Protein (Cat# AAA114727)

No reviews yet
Full Name
Recombinant Rotavirus A Intermediate capsid protein VP6
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Phosphoglycerate mutase 1 (GPM1), Recombinant Protein (Cat# AAA114729)

No reviews yet
Full Name
Recombinant Saccharomyces cerevisiae Phosphoglycerate mutase 1 (GPM1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114730_SDS_PAGE15.png SDS-PAGE

Antifungal protein (afp), Recombinant Protein (Cat# AAA114730)

No reviews yet
Full Name
Recombinant Antifungal protein (afp)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Hexon protein (PII), Recombinant Protein (Cat# AAA114733)

No reviews yet
Full Name
Recombinant Human adenovirus F serotype 41 Hexon protein (PII), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Serum amyloid A-1 protein (SAA1), Recombinant Protein (Cat# AAA114480)

No reviews yet
Full Name
Recombinant Mesocricetus auratus Serum amyloid A-1 protein (SAA1)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114487_SDS_PAGE15.jpg SDS-PAGE

Envelope glycoprotein B, Recombinant Protein (Cat# AAA114487)

No reviews yet
Full Name
Recombinant Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Envelope glycoprotein B
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Lysozyme C-2 (Lyz2), Recombinant Protein (Cat# AAA114488)

No reviews yet
Full Name
Recombinant Mouse Lysozyme C-2 (Lyz2)
Gene Names
Lyz2; Lys; Lzm; Lzp; Lysm; Lyzs; Lyzf2; Lzm-s1; AI326280
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114489_SDS_PAGE15.jpg SDS-PAGE

Acyl carrier protein (acpP), Recombinant Protein (Cat# AAA114489)

No reviews yet
Full Name
Recombinant Acyl carrier protein (acpP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114491_SDS_PAGE15.jpg SDS-PAGE

Outer capsid protein VP4, partial, Recombinant Protein (Cat# AAA114491)

No reviews yet
Full Name
Recombinant Rotavirus Outer capsid protein VP4, partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

(Rhesus macaque) Progonadoliberin-2 (GNRH2), Recombinant Protein (Cat# AAA114499)

No reviews yet
Full Name
Recombinant Macaca mulatta (Rhesus macaque) Progonadoliberin-2 (GNRH2)
Gene Names
GNRH2; Gn-RHII; LH-RHII
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114501_SDS_PAGE15.jpg SDS-PAGE

Glycerol-1-phosphate dehydrogenase [NAD(P)+], Recombinant Protein (Cat# AAA114501)

No reviews yet
Full Name
Recombinant Geobacillus stearothermophilus (Bacillus stearothermophilus) Glycerol-1-phosphate dehydrogenase [NAD(P)+]
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Sperm acrosome membrane-associated protein 3 (SPACA3), Recombinant Protein (Cat# AAA114519)

No reviews yet
Full Name
Recombinant Papio hamadryas Sperm acrosome membrane-associated protein 3 (SPACA3), partial
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114532_SDS_PAGE15.png SDS-PAGE

Enterotoxin type G, Recombinant Protein (Cat# AAA114532)

No reviews yet
Full Name
Recombinant Staphylococcus aureus (strain N315) Enterotoxin type G
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

Putative monooxygenase ydhR (ydhR), Recombinant Protein (Cat# AAA114533)

No reviews yet
Full Name
Recombinant Escherichia coli Putative monooxygenase ydhR (ydhR)
Gene Names
ydhR; ECK1663; JW1657
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

ELAV-like protein 4 (elavl4), Recombinant Protein (Cat# AAA114537)

No reviews yet
Full Name
Recombinant Xenopus tropicalis ELAV-like protein 4 (elavl4)
Gene Names
elavl4; HuD; elrD; elrD1; elrD2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114543_SDS_PAGE15.jpg SDS-PAGE

Serine protease inhibitor Kazal-type 3, Recombinant Protein (Cat# AAA114543)

No reviews yet
Full Name
Recombinant Mouse Serine protease inhibitor Kazal-type 3
Gene Names
Spink1; p12; Spink3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing
product-image-AAA114555_SDS_PAGE15.jpg SDS-PAGE

Low-density lipoprotein receptor-related protein 4, Recombinant Protein (Cat# AAA114555)

No reviews yet
Full Name
Recombinant Human Low-density lipoprotein receptor-related protein 4
Gene Names
LRP4; CLSS; CMS17; LRP-4; LRP10; MEGF7; SOST2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Pricing

What Are Recombinant Proteins?


A recombinant protein is created by inserting the gene of interest into a host system like E. coli, mammalian cells, or insect cells. This protein expression method results in the large-scale production of protein in a controlled environment with highly precise structures and functionality. Proteins produced via the “Recombinant” methodology have proven themselves crucial in various biological research areas, including immunology, neuroscience, cancer research, drug delivery and development, and more.


Core Recombinant Protein Product Lines:


  • Human: Produced from human genes (e.g., growth factors, cytokines).

  • Animal: Derived from mouse, rat, or other animals (e.g., mouse antibodies, enzymes).

  • Bacterial: Produced in bacteria like E. coli (e.g., enzymes, bacterial toxins).

  • Yeast: Produced in yeast cells (e.g., surface proteins, metabolic enzymes).

  • Insect:Expressed in insect cells (e.g., viral proteins, glycoproteins).

  • Viral: Derived from viral genomes (e.g., spike proteins for vaccine development).


How Does It Work?


  • Gene Identification and Cloning: Scientists first find the exact gene that codes for the protein they are interested in producing, and then create a copy of said gene.

  • Recombinant DNA Creation: The copied gene is then inserted into a vector (a vehicle-like plasmid) that can be transported safely into your intended expression host cell/system.

  • Host Cell Transformation: The vector (with the foreign gene inside) is shuttled into a host cell. This host can be a bacterium (like E. coli), yeast, insect cells, or mammalian cells, depending on the type of protein or protein characteristics needed.

  • Protein Expression:The host cell “reads” the copied gene that was shuttled into it, and begins to produce the gene’s coded-for protein using its own cellular machinery. The host can continue to multiply, and with each new cell, more protein is produced.

  • Protein Purification:After enough protein has been made, scientists collect the host cell and separate out the target protein. The protein is then carefully purified so it is free of contaminants, ideally active, and also safe for use.

The result is a purified recombinant protein — a lab-made protein that is biologically identical (in most respects) to the natural/native version.


We take this process a step further, offering recombinant proteins that are produced with precise control over sequence modifications, expression levels, and large-scale production. This ensures high-quality, consistent results that will be able to support your research needs and empower your scientific discoveries.


Some of the expression hosts/systems used in recombinant protein generation by AAA Biotech include:


  • Escherichia coli (E. coli)

  • Human (Homo sapiens)

  • Chinese Hamster

  • Yeast

  • Insect cells (e.g., Baculovirus expression system)

Advantages Of Our Recombinant Proteins:


Recombinant Protein Offerings


S.No Protein Expression Systems Quality and Bioactivity Formats and Flexibility
01. E. coli, HEK293, CHO, yeast, and insect cells Validated high bioactivity and binding activity Ready-to-use formats (lyophilized or liquid formulations available)
02. 675+ recombinant protein products High protein purity (≥95%) Available in flexible pack sizes
03. Custom protein production (His-tag, GST, FLAG, and Fc fusion) Lot-to-lot consistency through QC protocols Wide range of targets (Cytokines, growth factors, enzymes, receptors, signaling proteins, etc.)

Applications Of Our Recombinant Proteins


  • Studying protein interactions (protein–protein or protein–DNA).

  • Testing biological pathways with functional/activity assays.

  • Creating standard curves in ELISA and other tests.

  • Making antigens/immunogens for antibody production.

  • Drug discovery and screening.

  • Finding and confirming biomarkers.

  • Researching cell signaling and immunity.

  • Developing vaccines.

Read more about the applications of the recombinant proteins here!


Why Buy Recombinant Proteins from AAA Biotech?


1. High Purity & Verified Quality:


Most of our proteins are ≥ 95% pure. We also test the biological activity of our products where it's relevant (it will be indicated on the product page).


2. Multiple Expression Systems:


We offer proteins made in multiple host systems, and this enables researchers to pick the system that gives them the best folding, post-translational modifications, or functionality for their experiment requirements.


3. Custom & Flexible Options:


Need a special tag (His, GST, FLAG, Fc fusion)? Or a custom variant? We can provide it. Our proteins come in formats that are lab-friendly: lyophilized (dry) or “ready-to-use” liquid.


4. Rigorous Quality Control & Documentation:


Every batch is backed by strong QC. This means you can rely on product consistency — two different batches will perform similarly.


5. Wide Variety & Global Availability:


We carry a large and growing catalog of recombinant proteins to cover almost all needs in research (immunology, oncology, vaccine work, etc.)


6. Researcher-Focused Support:


Technical support, clear documentation, and user-friendly product pages help you select the right protein for your work. Plus, our user-friendly packaging and handling, and global shipping are all designed to reduce delays, damage, and hassles.


Order Recombinant Proteins Today!


We are committed to supporting the research community with recombinant proteins that display exceptional performance and reliability. Our proteins are produced using industry-standard methods and are validated to meet the needs of academic, pharmaceutical, and biotechnology laboratories.


We have a track record of delivering proteins that work — large numbers of researchers rely on them in many published studies. Browse our catalog to find the perfect protein for your research applications now!


FAQ


1. What is involved in the purification of recombinant proteins?


The purification process of these recombinant proteins is performed to isolate the specific protein produced by the host cell from unwanted substances. The process generally includes techniques such as “affinity chromatography” to separate the protein from other proteins and impurities. AAA Biotech generally offers proteins ≥ 95% pure, depending on the protein type.


2. What are some examples of popular AAA Biotech recombinant proteins?


Some examples of recombinant proteins include:


Retinoblastoma Protein (Cat # AAA10852) – reportedly used in vaccine research and antibody development. Hepatitis B Surface Antigen (HBsAg) (Cat# AAA13446) – reportedly used in diagnostic tests and vaccine development for Hepatitis B. High-Mobility Group Box 1 (HMGB1) (Cat# AAA10851) – reportedly used in inflammation and immune response research.


3. How are AAA Biotech recombinant proteins validated?


Each batch undergoes stringent quality control checks, including SDS-PAGE analysis, endotoxin testing (for select products), and activity assaying (for select products). Certificates of Analysis are provided with every product (only upon request for some products).


4. Are your proteins suitable for therapeutic development or only research?


AAA Biotech recombinant proteins are strictly for research-use only and are not intended for diagnostic or therapeutic purposes in humans or animals.


5. What types of expression systems do you use for recombinant protein production?


The production labs use a variety of expression platforms, including bacterial (E. coli), yeast, insect (baculovirus), and mammalian (HEK293, CHO) systems. The expression system used depends on the complexity and intended function/use of the protein.


Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.