Low-density lipoprotein receptor-related protein 4 Recombinant Protein | LRP4 recombinant protein

Recombinant Human Low-density lipoprotein receptor-related protein 4

Cat. Num. AAA114555

• Gene Names: LRP4; CLSS; CMS17; LRP-4; LRP10; MEGF7; SOST2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Low-density lipoprotein receptor-related protein 4; N/A; Recombinant Human Low-density lipoprotein receptor-related protein 4; Multiple epidermal growth factor-like domains 7; LRP4 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1747-1905aa; Cytoplasmic Domain
• Sequence: YRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV
• Sequence Length: 1905

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for LRP4 recombinant protein

Mediates SOST-dependent inhibition of bone formation. Functions as a specific facilitator of SOST-mediated inhibition of Wnt signaling. Plays a key role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Directly binds AGRIN and recruits it to the MUSK signaling complex. Mediates the AGRIN-induced phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane. Alternatively, may be involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway. More generally, has been proposed to function as a cell surface endocytic receptor binding and internalizing extracellular ligands for degradation by lysosomes.

Product Categories/Family for LRP4 recombinant protein

Cardiovascular

References

Low density lipoprotein receptor-related protein 10.Ishikawa K., Fujimoto H., Kim D., Saeki S. Identification of high-molecular-weight proteins with multiple EGF-like motifs by motif-trap screening.Nakayama M., Nakajima D., Nagase T., Nomura N., Seki N., Ohara O.Genomics 51:27-34(1998) Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006) LRP4 mutations alter Wnt/beta-catenin signaling and cause limb and kidney malformations in Cenani-Lenz syndrome.Li Y., Pawlik B., Elcioglu N., Aglan M., Kayserili H., Yigit G., Percin F., Goodman F., Nurnberg G., Cenani A., Urquhart J., Chung B.D., Ismail S., Amr K., Aslanger A.D., Becker C., Netzer C., Scambler P., Eyaid W., Hamamy H., Clayton-Smith J., Hennekam R., Nurnberg P., Herz J., Temtamy S.A., Wollnik B.Am. J. Hum. Genet. 86:696-706(2010) Bone overgrowth-associated mutations in the LRP4 gene impair sclerostin facilitator function.Leupin O., Piters E., Halleux C., Hu S., Kramer I., Morvan F., Bouwmeester T., Schirle M., Bueno-Lozano M., Fuentes F.J., Itin P.H., Boudin E., de Freitas F., Jennes K., Brannetti B., Charara N., Ebersbach H., Geisse S., Lu C.X., Bauer A., Van Hul W., Kneissel M.J. Biol. Chem. 286:19489-19500(2011)

NCBI and Uniprot Product Information

• NCBI GI #: 157384998
• NCBI GeneID: 4038
• NCBI Accession #: NP_002325.2
• NCBI GenBank Nucleotide #: NM_002334.3
• UniProt Accession #: O75096; Q4AC85; Q5KTZ5; B2RN39
• Molecular Weight: 19.9 kDa
• NCBI Official Full Name: low-density lipoprotein receptor-related protein 4
• NCBI Official Synonym Full Names: LDL receptor related protein 4
• NCBI Official Symbol: LRP4
• NCBI Official Synonym Symbols: CLSS; CMS17; LRP-4; LRP10; MEGF7; SOST2
• NCBI Protein Information: low-density lipoprotein receptor-related protein 4
• UniProt Protein Name: Low-density lipoprotein receptor-related protein 4
• UniProt Gene Name: LRP4
• UniProt Synonym Gene Names: KIAA0816; LRP10; MEGF7; LRP-4
• UniProt Entry Name: LRP4_HUMAN