Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SRC Polyclonal Antibody – Cat# AAA197375 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Proto-Oncogene Tyrosine-Protein Kinase Src (SRC) Antibody – Rabbit Polyclonal

SRC antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
SRC; ASV; SRC1; THC6; c-SRC; p60-Src
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SRC, Antibody; SRC antibody - N-terminal region; anti-SRC antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG
Sequence Length
536
Applicable Applications for anti-SRC antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SRC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

Rabbit Anti-SRC Polyclonal Antibody – Cat# AAA197375 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-SRC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: 293T cell lysate)

WB (Western Blot)

(Host: MouseTarget Name: SRCSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit Anti-SRC Polyclonal Antibody – Cat# AAA197375 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: SRCSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: SRCSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)

Rabbit Anti-SRC Polyclonal Antibody – Cat# AAA197375 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: SRCSample Tissue: Mouse LiverAntibody Dilution: 1ug/ml)
Related Product Information for anti-SRC antibody
This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot

Target Description: This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
proto-oncogene tyrosine-protein kinase Src
NCBI Official Synonym Full Names
SRC proto-oncogene, non-receptor tyrosine kinase
NCBI Official Symbol
SRC
NCBI Official Synonym Symbols
ASV; SRC1; THC6; c-SRC; p60-Src
NCBI Protein Information
proto-oncogene tyrosine-protein kinase Src
UniProt Protein Name
Proto-oncogene tyrosine-protein kinase Src
UniProt Gene Name
SRC
UniProt Synonym Gene Names
SRC1; p60-Src
UniProt Entry Name
SRC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SRC src (Catalog #AAA197375) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRC antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SRC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the SRC src for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTPSKPASAD GHRGPSAAFA PAAAEPKLFG GFNSSDTVTS PQRAGPLAGG. It is sometimes possible for the material contained within the vial of "SRC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.