Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-SRC Monoclonal Antibody – Cat# AAA28491 – IP (Immunoprecipitation) IP (Immunoprecipitation) (Immunoprecipitation analysis of 600 ug extracts of Mouse brain using 3 ug Src antibody (AAA28491). Western blot was performed from the immunoprecipitate using Src antibody (AAA28491) at a dilution of 1:1000.)

Proto-Oncogene Tyrosine-Protein Kinase Src (SRC) Antibody – Rabbit Monoclonal

[KO Validated] Src Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity purification
Synonyms
Src, Antibody; [KO Validated] Src Rabbit mAb; ASV; SRC1; THC6; c-SRC; p60-Src; rc; anti-SRC antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTE
Applicable Applications for anti-SRC antibody
WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:1000-1:2000
IF/ICC: 1:100-1:400
IP: 0.5ug-4ug antibody for 400ug-600ug extracts of whole cells
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Src (P12931).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 600 ug extracts of Mouse brain using 3 ug Src antibody (AAA28491). Western blot was performed from the immunoprecipitate using Src antibody (AAA28491) at a dilution of 1:1000.)

Rabbit Anti-SRC Monoclonal Antibody – Cat# AAA28491 – IP (Immunoprecipitation) IP (Immunoprecipitation) (Immunoprecipitation analysis of 600 ug extracts of Mouse brain using 3 ug Src antibody (AAA28491). Western blot was performed from the immunoprecipitate using Src antibody (AAA28491) at a dilution of 1:1000.)

ICC (Immunocytochemistry)

(Confocal imaging of NIH/3T3 cells using [KO Validated] Src Rabbit mAb (AAA28491,at dilution of 1:100) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

Rabbit Anti-SRC Monoclonal Antibody – Cat# AAA28491 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of NIH/3T3 cells using [KO Validated] Src Rabbit mAb (AAA28491,at dilution of 1:100) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

ICC (Immunocytochemistry)

(Confocal imaging of A549 cells using [KO Validated] Src Rabbit mAb (AAA28491,at dilution of 1:100) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

Rabbit Anti-SRC Monoclonal Antibody – Cat# AAA28491 – ICC (Immunocytochemistry) ICC (Immunocytochemistry) (Confocal imaging of A549 cells using [KO Validated] Src Rabbit mAb (AAA28491,at dilution of 1:100) (Red). The cells were counterstained with ?-Tubulin Mouse mAb (AC012,dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.)

WB (Western Blot)

(Western blot analysis of lysates from Jurkat cells, using [KO Validated] Src Rabbit mAb (AAA28491) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)

Rabbit Anti-SRC Monoclonal Antibody – Cat# AAA28491 – WB (Western Blot) WB (Western Blot) (Western blot analysis of lysates from Jurkat cells, using [KO Validated] Src Rabbit mAb (AAA28491) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)

WB (Western Blot)

(Western blot analysis of lysates from wild type (WT) and Src knockout (KO) HeLa cells, using [KO Validated] Src Rabbit mAb (AAA28491) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)

Rabbit Anti-SRC Monoclonal Antibody – Cat# AAA28491 – WB (Western Blot) WB (Western Blot) (Western blot analysis of lysates from wild type (WT) and Src knockout (KO) HeLa cells, using [KO Validated] Src Rabbit mAb (AAA28491) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.)

WB (Western Blot)

(Western blot analysis of various lysates using [KO Validated] Src Rabbit mAb (AAA28491) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit Anti-SRC Monoclonal Antibody – Cat# AAA28491 – WB (Western Blot) WB (Western Blot) (Western blot analysis of various lysates using [KO Validated] Src Rabbit mAb (AAA28491) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)
Related Product Information for anti-SRC antibody
This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. The protein encoded by this gene is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer. Two transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated MW: 60kDa
Observed MW: 60kDa
UniProt Protein Name
Proto-oncogene tyrosine-protein kinase Src
UniProt Gene Name
SRC
UniProt Synonym Gene Names
SRC1; p60-Src
UniProt Entry Name
SRC_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The SRC src (Catalog #AAA28491) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The [KO Validated] Src Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Src can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA. WB: 1:1000-1:2000 IF/ICC: 1:100-1:400 IP: 0.5ug-4ug antibody for 400ug-600ug extracts of whole cells ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the SRC src for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSNKSKPKD ASQRRRSLEP AENVHGAGGG AFPASQTPSK PASADGHRGP SAAFAPAAAE PKLFGGFNSS DTVTSPQRAG PLAGGVTTFV ALYDYESRTE. It is sometimes possible for the material contained within the vial of "Src, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.