Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA201653 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)

Receptor-Interacting Serine/Threonine-Protein Kinase 3 (RIPK3) Antibody – Rabbit Polyclonal

RIPK3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
RIPK3; RIP3
Reactivity
Tested Species Reactivity: Human, Rat
Predicted Species Reactivity: Human, Rat, Dog, Horse
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RIPK3, Antibody; RIPK3 antibody - middle region; anti-RIPK3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human, Rat
Predicted Species Reactivity: Human, Rat, Dog, Horse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: ETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
Sequence Length
518
Applicable Applications for anti-RIPK3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Dog: 92%; Horse: 92%; Human: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RIPK3
Protein Size (# AA)
518 amino acids
Blocking Peptide
RIPK3 peptide ( ) is used for blocking the activity of RIPK3 antibody (MBS3224322)
Protein Interactions
BMH1; RFX6; FADD; RIPK1; CASP8; INPP5K; CDC37; STIP1; PYGL; FKBP5; FKBP4; CTNND1; UBC; XIAP; BIRC3; BIRC2; TICAM1; TRAF2; TNFRSF1A;
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA201653 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: PANC1 cell lysate)

WB (Western Blot)

(Host: RatTarget Name: RIPK3Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA201653 – WB (Western Blot) WB (Western Blot) (Host: RatTarget Name: RIPK3Sample Tissue: Rat BrainAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Spleen)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA201653 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Spleen)
Related Product Information for anti-RIPK3 antibody
This is a rabbit polyclonal antibody against RIPK3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
receptor-interacting serine/threonine-protein kinase 3
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 3
NCBI Official Symbol
RIPK3
NCBI Official Synonym Symbols
RIP3
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 3
UniProt Gene Name
RIPK3
UniProt Synonym Gene Names
RIP3; RIP-3
UniProt Entry Name
RIPK3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RIPK3 ripk3 (Catalog #AAA201653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIPK3 antibody - middle region reacts with Tested Species Reactivity: Human, Rat Predicted Species Reactivity: Human, Rat, Dog, Horse and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RIPK3 ripk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETPGLEGLKE LMQLCWSSEP KDRPSFQECL PKTDEVFQMV ENNMNAAVST. It is sometimes possible for the material contained within the vial of "RIPK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.