Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – WB (Western Blot) WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

Receptor-Interacting Serine/Threonine-Protein Kinase 3 (RIPK3) Antibody – Rabbit Polyclonal

RIPK3 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
RIPK3; RIP3
Reactivity
Tested Species Reactivty: Human
Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
RIPK3, Antibody; RIPK3 antibody - N-terminal region; RIP3; RIP3 beta, RIP3 gamma; anti-RIPK3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivty: Human
Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
1.0 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAG
Sequence Length
518
Applicable Applications for anti-RIPK3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3
Conjugation
Unconjugated
Protein Size (#AA)
518 amino acids
Protein Interactions
BMH1; RFX6; FADD; RIPK1; CASP8; INPP5K; CDC37; STIP1; PYGL; FKBP5; FKBP4; CTNND1; UBC; XIAP; BIRC3; BIRC2; TICAM1; TRAF2; TNFRSF1A;
Enhanced Validation
Relative Expression (Western Blot)
Blocking Peptide
For anti-RIPK3 (AAA23385) antibody is Catalog #
Preparation and Storage
For short term use, store at 2°C to 8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – WB (Western Blot) WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

WB (Western Blot)

(Host: RabbitTarget: RIPK3Positive control (+): THP-1 (N30)Negative control (-): A549 (N03)Antibody concentration: 1ug/ml)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget: RIPK3Positive control (+): THP-1 (N30)Negative control (-): A549 (N03)Antibody concentration: 1ug/ml)

WB (Western Blot)

(WB Suggested Anti-RIPK3 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RIPK3 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(WB Suggested Anti-RIPK3 antibody Titration: 1 ug/mLSample Type: Human Jurkat)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RIPK3 antibody Titration: 1 ug/mLSample Type: Human Jurkat)

WB (Western Blot)

(WB Suggested Anti-RIPK3 antibody Titration: 1 ug/mLSample Type: Human HepG2)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-RIPK3 antibody Titration: 1 ug/mLSample Type: Human HepG2)

WB (Western Blot)

(Host: RabbitTarget Name: RIPK3Sample Type: Lane 1: Transient overexpression lysate of RIPK3Lane 2: Non-overexpressed vector control lysateAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: RIPK3Sample Type: Lane 1: Transient overexpression lysate of RIPK3Lane 2: Non-overexpressed vector control lysateAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(RIPK3 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pancreas TissueObserved Staining: Cytoplasmic in endocrine part (islets) of the pancreas. No staining observed in exocrine cellsPrimary Antibody Concentration: 3 -12 ug/mlSecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure: 0.2 seconds)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (RIPK3 antibody - N-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pancreas TissueObserved Staining: Cytoplasmic in endocrine part (islets) of the pancreas. No staining observed in exocrine cellsPrimary Antibody Concentration: 3 -12 ug/mlSecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure: 0.2 seconds)

IHC (Immunohistochemistry)

(Human Liver)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Liver)

IHC (Immunohistochemistry)

(Human Heart)

Rabbit Anti-RIPK3 Polyclonal Antibody – Cat# AAA23385 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Heart)
Related Product Information for anti-RIPK3 antibody
This is a rabbit polyclonal antibody against RIPK3. It was validated on Western Blot and immunohistochemistry

Target Description: RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
receptor-interacting serine/threonine-protein kinase 3
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 3
NCBI Official Symbol
RIPK3
NCBI Official Synonym Symbols
RIP3
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 3
UniProt Protein Name
Receptor-interacting serine/threonine-protein kinase 3
UniProt Gene Name
RIPK3
UniProt Synonym Gene Names
RIP3; RIP-3
UniProt Entry Name
RIPK3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RIPK3 ripk3 (Catalog #AAA23385) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RIPK3 antibody - N-terminal region reacts with Tested Species Reactivty: Human Predicted Species Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RIPK3 ripk3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGSQSGTGSG EPGGTLGYLA PELFVNVNRK ASTASDVYSF GILMWAVLAG. It is sometimes possible for the material contained within the vial of "RIPK3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.