Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200523_WB11.jpg WB (Western Blot) (WB Suggested Anti-RHOC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Rabbit RHOC Polyclonal Antibody | anti-RHOC antibody

RHOC antibody - N-terminal region

Gene Names
RHOC; H9; ARH9; ARHC; RHOH9
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
RHOC, Antibody; RHOC antibody - N-terminal region; anti-RHOC antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF
Sequence Length
193
Applicable Applications for anti-RHOC antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human RHOC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-RHOC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

product-image-AAA200523_WB11.jpg WB (Western Blot) (WB Suggested Anti-RHOC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

WB (Western Blot)

(Lanes:Lane 1: 20ug of Brugia malayi total worm extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:RHOCSubmitted by:Peter U. Fischer, Washington University School of Medicine)

product-image-AAA200523_WB13.jpg WB (Western Blot) (Lanes:Lane 1: 20ug of Brugia malayi total worm extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:5000Gene Name:RHOCSubmitted by:Peter U. Fischer, Washington University School of Medicine)

IHC (Immunohistochemistry)

(Sample Type :Brugia malayi intestinal cross sectionPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-APSecondary Antibody Dilution :1:5000Gene Name :RHOCSubmitted by :Peter U. Fischer, Ph.D., Research Associate Professor, Washington University School of Medicine, Infectious Disease Division, Campus Mailbox 8051, 660 S. Euclid Ave, St. Louis, MO 63110 USA, Tel 314-454-7876 Fax 314-454-5293)

product-image-AAA200523_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Brugia malayi intestinal cross sectionPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-APSecondary Antibody Dilution :1:5000Gene Name :RHOCSubmitted by :Peter U. Fischer, Ph.D., Research Associate Professor, Washington University School of Medicine, Infectious Disease Division, Campus Mailbox 8051, 660 S. Euclid Ave, St. Louis, MO 63110 USA, Tel 314-454-7876 Fax 314-454-5293)
Related Product Information for anti-RHOC antibody
This is a rabbit polyclonal antibody against RHOC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-RHOC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
389
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
rho-related GTP-binding protein RhoC
NCBI Official Synonym Full Names
ras homolog family member C
NCBI Official Symbol
RHOC
NCBI Official Synonym Symbols
H9; ARH9; ARHC; RHOH9
NCBI Protein Information
rho-related GTP-binding protein RhoC
UniProt Protein Name
Rho-related GTP-binding protein RhoC
UniProt Gene Name
RHOC
UniProt Synonym Gene Names
ARH9; ARHC; h9
UniProt Entry Name
RHOC_HUMAN

Similar Products

Product Notes

The RHOC rhoc (Catalog #AAA200523) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOC antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RHOC can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the RHOC rhoc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPTVFENYIA DIEVDGKQVE LALWDTAGQE DYDRLRPLSY PDTDVILMCF. It is sometimes possible for the material contained within the vial of "RHOC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.