Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ELK1 Polyclonal Antibody – Cat# AAA198349 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ELK1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateELK1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

ETS Domain-Containing Protein Elk-1 Isoform A (ELK1) Antibody – Rabbit Polyclonal

ELK1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
ELK1, Antibody; ELK1 antibody - N-terminal region; anti-ELK1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRK
Sequence Length
428
Applicable Applications for anti-ELK1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ELK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ELK1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateELK1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit Anti-ELK1 Polyclonal Antibody – Cat# AAA198349 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ELK1 Antibody Titration: 2.5ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysateELK1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

IHC (Immunohistochemistry)

(Rabbit Anti-ELK1 antibodyParaffin Embedded Tissue: Human Placenta cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit Anti-ELK1 Polyclonal Antibody – Cat# AAA198349 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-ELK1 antibodyParaffin Embedded Tissue: Human Placenta cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)
Related Product Information for anti-ELK1 antibody
This is a rabbit polyclonal antibody against ELK1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ELK1 is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. ELK1 is a nuclear target for the ras-raf-MAPK signaling cascade.This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is a nuclear target for the ras-raf-MAPK signaling cascade.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
ETS domain-containing protein Elk-1 isoform a
NCBI Official Synonym Full Names
ETS transcription factor ELK1
NCBI Official Symbol
ELK1
NCBI Protein Information
ETS domain-containing protein Elk-1
UniProt Protein Name
ETS domain-containing protein Elk-1
UniProt Gene Name
ELK1
UniProt Entry Name
ELK1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ELK1 elk1 (Catalog #AAA198349) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELK1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ELK1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ELK1 elk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDPSVTLWQF LLQLLREQGN GHIISWTSRD GGEFKLVDAE EVARLWGLRK. It is sometimes possible for the material contained within the vial of "ELK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.