Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PSMA3 Polyclonal Antibody – Cat# AAA200736 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)

Proteasome Subunit Alpha Type-3 Isoform 2 (PSMA3) Antibody – Rabbit Polyclonal

PSMA3 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PSMA3; HC8; PSC3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PSMA3, Antibody; PSMA3 antibody - middle region; anti-PSMA3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN
Sequence Length
248
Applicable Applications for anti-PSMA3 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PSMA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)

Rabbit Anti-PSMA3 Polyclonal Antibody – Cat# AAA200736 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PSMA3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human brain)

WB (Western Blot)

(Host: RabbitTarget Name: PSMA3Sample Type: Human HelaAntibody Dilution: 1.0ug/mlPSMA3 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit Anti-PSMA3 Polyclonal Antibody – Cat# AAA200736 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PSMA3Sample Type: Human HelaAntibody Dilution: 1.0ug/mlPSMA3 is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: PSMA3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlPSMA3 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit Anti-PSMA3 Polyclonal Antibody – Cat# AAA200736 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PSMA3Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlPSMA3 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-PSMA3 antibody
This is a rabbit polyclonal antibody against PSMA3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA3 is a member of the peptidase T1A family, that is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Product Categories/Family for anti-PSMA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
proteasome subunit alpha type-3 isoform 2
NCBI Official Synonym Full Names
proteasome subunit alpha 3
NCBI Official Symbol
PSMA3
NCBI Official Synonym Symbols
HC8; PSC3
NCBI Protein Information
proteasome subunit alpha type-3
UniProt Protein Name
Proteasome subunit alpha type-3
UniProt Gene Name
PSMA3
UniProt Synonym Gene Names
HC8; PSC8
UniProt Entry Name
PSA3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PSMA3 psma3 (Catalog #AAA200736) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSMA3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PSMA3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PSMA3 psma3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKDKAFELEL SWVGELTNGR HEIVPKDIRE EAEKYAKESL KEEDESDDDN. It is sometimes possible for the material contained within the vial of "PSMA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.