Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-PIWIL1 Polyclonal Antibody – Cat# AAA198870 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PIWIL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: CCRF-CEM cell lysatePIWIL1 is supported by BioGPS gene expression data to be expressed in CCRT-CEM)

Piwi-Like Protein 1 Isoform 1 (PIWIL1) Antibody – Rabbit Polyclonal

PIWIL1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
PIWIL1; HIWI; MIWI; PIWI; CT80.1
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIWIL1, Antibody; PIWIL1 antibody - middle region; HIWI, MIWI, PIWI, CT80.1; anti-PIWIL1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY
Sequence Length
861
Applicable Applications for anti-PIWIL1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PIWIL1
Protein Size (# AA)
861 amino acids
Protein Interactions
UBC; DICER1; TP63; TP73; TP53;
Blocking Peptide
PIWIL1 peptide ( ) is used for blocking the activity of PIWIL1 antibody (MBS3205786)
Preparation and Storage
For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-PIWIL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: CCRF-CEM cell lysatePIWIL1 is supported by BioGPS gene expression data to be expressed in CCRT-CEM)

Rabbit Anti-PIWIL1 Polyclonal Antibody – Cat# AAA198870 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-PIWIL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: CCRF-CEM cell lysatePIWIL1 is supported by BioGPS gene expression data to be expressed in CCRT-CEM)

WB (Western Blot)

(Host: RabbitTarget Name: PIWIL1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit Anti-PIWIL1 Polyclonal Antibody – Cat# AAA198870 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: PIWIL1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PIWIL1 antibody
Target Description: PIWIL1 is a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. PIWIL1 may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells.This gene encodes a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. The encoded protein may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells.
Product Categories/Family for anti-PIWIL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
piwi-like protein 1 isoform 1
NCBI Official Synonym Full Names
piwi like RNA-mediated gene silencing 1
NCBI Official Symbol
PIWIL1
NCBI Official Synonym Symbols
HIWI; MIWI; PIWI; CT80.1
NCBI Protein Information
piwi-like protein 1
UniProt Protein Name
Piwi-like protein 1
UniProt Gene Name
PIWIL1
UniProt Synonym Gene Names
HIWI
UniProt Entry Name
PIWL1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The PIWIL1 piwil1 (Catalog #AAA198870) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIWIL1 antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's PIWIL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the PIWIL1 piwil1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LTYKLCHIYY NWPGVIRVPA PCQYAHKLAF LVGQSIHREP NLSLSNRLYY. It is sometimes possible for the material contained within the vial of "PIWIL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.