Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-FKBP8 Polyclonal Antibody – Cat# AAA199758 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FKBP8 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Peptidyl-Prolyl Cis-Trans Isomerase FKBP8 Isoform 1 (FKBP8) Antibody – Rabbit Polyclonal

FKBP8 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
FKBP8; FKBP38; FKBPr38
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
FKBP8, Antibody; FKBP8 antibody - N-terminal region; anti-FKBP8 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS
Sequence Length
413
Applicable Applications for anti-FKBP8 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FKBP8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-FKBP8 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Rabbit Anti-FKBP8 Polyclonal Antibody – Cat# AAA199758 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-FKBP8 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

IHC (Immunohistochemistry)

(Rabbit Anti-FKBP8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-FKBP8 Polyclonal Antibody – Cat# AAA199758 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-FKBP8 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Liver TissueObserved Staining: Cytoplasm in hepatocytesPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-FKBP8 antibody
This is a rabbit polyclonal antibody against FKBP8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FKBP8 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, it does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. Unlike the other members of the family, this encoded protein does not seem to have PPIase/rotamase activity. It may have a role in neurons associated with memory function. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-FKBP8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP8 isoform 1
NCBI Official Synonym Full Names
FKBP prolyl isomerase 8
NCBI Official Symbol
FKBP8
NCBI Official Synonym Symbols
FKBP38; FKBPr38
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP8
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP8
UniProt Gene Name
FKBP8
UniProt Synonym Gene Names
FKBP38; PPIase FKBP8; 38 kDa FKBP; FKBP-38; hFKBP38; FKBP-8
UniProt Entry Name
FKBP8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The FKBP8 fkbp8 (Catalog #AAA199758) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP8 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP8 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FKBP8 fkbp8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GPPGSSRPVK GQVVTVHLQT SLENGTRVQE EPELVFTLGD CDVIQALDLS. It is sometimes possible for the material contained within the vial of "FKBP8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.