Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ENO1 Polyclonal Antibody – Cat# AAA201794 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ENO1 Antibody Titration: 0.5ug/mlPositive Control: Jurkat cell lysateENO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Alpha-Enolase Isoform 1 (ENO1) Antibody – Rabbit Polyclonal

ENO1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ENO1; NNE; PPH; MPB1; ENO1L1; HEL-S-17
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Synonyms
ENO1, Antibody; ENO1 antibody - middle region; anti-ENO1 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSGGMTHSDQPKEDRQGVNEKSCNCLLLKVNQIGSVTESLQACKLAQANG
Sequence Length
434
Applicable Applications for anti-ENO1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ENO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ENO1 Antibody Titration: 0.5ug/mlPositive Control: Jurkat cell lysateENO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit Anti-ENO1 Polyclonal Antibody – Cat# AAA201794 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ENO1 Antibody Titration: 0.5ug/mlPositive Control: Jurkat cell lysateENO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

IHC (Immunohistochemistry)

(Sample Type: Human LiverAnti-ENO1 antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. ENO1 Antibody concentration 5 ug/ml.)

Rabbit Anti-ENO1 Polyclonal Antibody – Cat# AAA201794 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type: Human LiverAnti-ENO1 antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. ENO1 Antibody concentration 5 ug/ml.)
Related Product Information for anti-ENO1 antibody
This is a rabbit polyclonal antibody against ENO1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ENO1 encodes one of three enolase isoenzymes found in mammals; it encodes alpha-enolase, a homodimeric soluble enzyme, and also encodes a shorter monomeric structural lens protein, tau-crystallin. The two proteins are made from the same message. The full length protein, the isoenzyme, is found in the cytoplasm. The shorter protein is produced from an alternative translation start, is localized to the nucleus, and has been found to bind to an element in the c-myc promoter. A pseudogene has been identified that is located on the other arm of the same chromosome.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
alpha-enolase isoform 1
NCBI Official Synonym Full Names
enolase 1
NCBI Official Symbol
ENO1
NCBI Official Synonym Symbols
NNE; PPH; MPB1; ENO1L1; HEL-S-17
NCBI Protein Information
alpha-enolase; c-myc promoter-binding protein-1
UniProt Protein Name
Alpha-enolase
UniProt Gene Name
ENO1
UniProt Synonym Gene Names
ENO1L1; MBPB1; MPB1; NNE
UniProt Entry Name
ENOA_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ENO1 eno1 (Catalog #AAA201794) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENO1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENO1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ENO1 eno1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSGGMTHSDQ PKEDRQGVNE KSCNCLLLKV NQIGSVTESL QACKLAQANG. It is sometimes possible for the material contained within the vial of "ENO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.