Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23611_WB7.jpg WB (Western Blot) (WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Rabbit EGR2 Polyclonal Antibody | anti-EGR2 antibody

EGR2 antibody - C-terminal region

Gene Names
EGR2; CHN1; AT591; CMT1D; CMT4E; KROX20
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
EGR2, Antibody; EGR2 antibody - C-terminal region; anti-EGR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG
Sequence Length
476
Applicable Applications for anti-EGR2 antibody
Immunohistochemistry (IHC)-FP, Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human EGR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

product-image-AAA23611_WB7.jpg WB (Western Blot) (WB Suggested Anti-EGR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

WB (Western Blot)

(Host: RatTarget Name: EGR2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

product-image-AAA23611_WB6.jpg WB (Western Blot) (Host: RatTarget Name: EGR2Sample Tissue: Rat Skeletal MuscleAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EGR2Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23611_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: EGR2Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: EGR2Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA23611_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: EGR2Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: EGR2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

product-image-AAA23611_WB3.jpg WB (Western Blot) (Host: MouseTarget Name: EGR2Sample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-EGR2 AntibodyParaffin Embedded Tissue: Human bronchiole epitheliumCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA23611_IHC2.jpg IHC (Immunohistochemistry) (Rabbit Anti-EGR2 AntibodyParaffin Embedded Tissue: Human bronchiole epitheliumCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Human Intestine)

product-image-AAA23611_IHC.jpg IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-EGR2 antibody
This is a rabbit polyclonal antibody against EGR2. It was validated on Western Blot and immunohistochemistry

Target Description: The early growth response protein 2 (EGR2) is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1.The early growth response protein 2 is a transcription factor with three tandem C2H2-type zinc fingers. Mutations in this gene are associated with the autosomal dominant Charcot-Marie-Tooth disease, type 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
E3 SUMO-protein ligase EGR2 isoform a
NCBI Official Synonym Full Names
early growth response 2
NCBI Official Symbol
EGR2
NCBI Official Synonym Symbols
CHN1; AT591; CMT1D; CMT4E; KROX20
NCBI Protein Information
E3 SUMO-protein ligase EGR2
UniProt Protein Name
E3 SUMO-protein ligase EGR2
UniProt Gene Name
EGR2
UniProt Synonym Gene Names
KROX20; EGR-2
UniProt Entry Name
EGR2_HUMAN

Similar Products

Product Notes

The EGR2 egr2 (Catalog #AAA23611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EGR2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EGR2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC)-FP, Western Blot (WB). Researchers should empirically determine the suitability of the EGR2 egr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFACDYCGRK FARSDERKRH TKIHLRQKER KSSAPSASVP APSTASCSGG. It is sometimes possible for the material contained within the vial of "EGR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.