Glycophorin-A Isoform 3 (GYPA) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Glycophorin-A
Gene Names
GYPA; MN; GPA; MNS; GPSAT; PAS-2; CD235a; GPErik; HGpMiV; HGpMiXI; HGpSta(C)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Glycophorin-A; N/A; Recombinant Human Glycophorin-A; MN sialoglycoprotein; PAS-2Sialoglycoprotein alpha; CD235a; GYPA recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-91aa; Extracellular Domain
Sequence
LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for GYPA recombinant protein
Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane. Is a receptor for influenza virus. Is a receptor for Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans. Appears to be a receptor for Hepatitis A virus (HAV).
Product Categories/Family for GYPA recombinant protein
References
Isolation and characterization of human glycophorin A cDNA clones by a synthetic oligonucleotide approach
nucleotide sequence and mRNA structure.Siebert P.D., Fukuda M.Proc. Natl. Acad. Sci. U.S.A. 83:1665-1669(1986)
Isolation of cDNA clones for human erythrocyte membrane sialoglycoproteins alpha and delta.Tate C.G., Tanner M.J.A.Biochem. J. 254:743-750(1988)
Structural organization of glycophorin A and B genes
glycophorin B gene evolved by homologous recombination at Alu repeat sequences.Kudo S., Fukuda M.Proc. Natl. Acad. Sci. U.S.A. 86:4619-4623(1989)
The mechanism of production of multiple mRNAs for human glycophorin A.Jawad K., Burness T.H.Nucleic Acids Res. 18:5829-5836(1990)
Characterization of glycophorin A transcripts
control by the common erythroid-specific promoter and alternative usage of different polyadenylation signals.Kudo S., Onda M., Fukuda M.J. Biochem. 116:183-192(1994)
Extensive alternative splicing of glycophorins in Southeast Asian populations.Hsu K., Huang S.-Y., Chi N., Lin M. Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)
Generation and annotation of the DNA sequences of human chromosomes 2 and 4.Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.Nature 434:724-731(2005)
Molecular biological study of the structure and expression of human glycophorin A.Siebert P.D., Fukuda M.Rev. Fr. Transfus. Immunohematol. 29:251-266(1986)
Amino-acid sequence and oligosaccharide attachment sites of human erythrocyte glycophorin.Tomita M., Marchesi V.T.Proc. Natl. Acad. Sci. U.S.A. 72:2964-2968(1975)
Furthmayr H., Galardy R., Tomita M., Marchesi V.T.Submitted (JUN-1977)
to the PIR data bankCharacterization of cDNA clones for human glycophorin A. Use for gene localization and for analysis of normal of glycophorin-A-deficient (Finnish type)
genomic DNA.Rahuel C., London J., D'Auriol L., Mattei M.-G., Tournamille C., Skrzynia C., Lebouc Y., Galibert F., Cartron J.-P.Eur. J. Biochem. 172:147-153(1988)
Mg and Mc
mutations within the amino-terminal region of glycophorin A.Furthmayr H., Metaxas M.N., Metaxas-Buhler M.Proc. Natl. Acad. Sci. U.S.A. 78:631-635(1981)
Amino acid and carbohydrate structural variants of glycoprotein products (M-N glycoproteins)
of the M-N allelic locus.Blumenfeld O.O., Adamany A.M., Puglia K.V.Proc. Natl. Acad. Sci. U.S.A. 78:747-751(1981)
Structural studies on human erythrocyte glycoproteins. Alkali-labile oligosaccharides.Thomas D.B., Winzler R.J.J. Biol. Chem. 244:5943-5946(1969)
Erythrocytes deficiency in glycophorin resist invasion by the malarial parasite Plasmodium falciparum.Pasvol G., Wainscoat J.S., Weatherall D.J.Nature 297:64-66(1982)
Structures of novel sialylated O-linked oligosaccharides isolated from human erythrocyte glycophorins.Fukuda M., Lauffenburger M., Sasaki H., Rogers M.E., Dell A.J. Biol. Chem. 262:11952-11957(1987)
The glycophorin A transmembrane domain dimer
sequence-specific propensity for a right-handed supercoil of helices.Treutlein H.R., Lemmon M.A., Engelman D.M., Brunger A.T.Biochemistry 31:12726-12732(1992)
Glycosylation sites identified by solid-phase Edman degradation
O-linked glycosylation motifs on human glycophorin A.Pisano A., Redmond J.W., Williams K.L., Gooley A.A.Glycobiology 3:429-435(1993)
Receptor and ligand domains for invasion of erythrocytes by Plasmodium falciparum.Sim B.K., Chitnis C.E., Wasniowska K., Hadley T.J., Miller L.H.Science 264:1941-1944(1994)
Identification of blood group A and B antigens in human glycophorin.Podbielska M., Krotkiewski H.Arch. Immunol. Ther. Exp. 48:211-221(2000)
Red-cell glycophorin A-band 3 interactions associated with the movement of band 3 to the cell surface.Young M.T., Beckmann R., Toye A.M., Tanner M.J.Biochem. J. 350:53-60(2000)
Glycophorin A dimerization and band 3 interaction during erythroid membrane biogenesis
in vivo studies in human glycophorin A transgenic mice.Auffray I., Marfatia S., de Jong K., Lee G., Huang C.H., Paszty C., Tanner M.J., Mohandas N., Chasis J.A.Blood 97:2872-2878(2001)
In vivo detection of hetero-association of glycophorin-A and its mutants within the membrane.Gerber D., Shai Y.J. Biol. Chem. 276:31229-31232(2001)
Distinct regions of human glycophorin A enhance human red cell anion exchanger (band 3; AE1)
transport function and surface trafficking.Young M.T., Tanner M.J.J. Biol. Chem. 278:32954-32961(2003)
The blood group system.Reid M.E., Christine Lomas-Francis C.(In)
Reid M.E., Christine Lomas-Francis C. (eds.)
;The blood group antigen factsbook, pp.29-104, Academic Press, Oxford (2004)
ABH blood group antigens in O-glycans of human glycophorin A.Podbielska M., Fredriksson S.A., Nilsson B., Lisowska E., Krotkiewski H.Arch. Biochem. Biophys. 429:145-153(2004)
Altered structure and anion transport properties of band 3 (AE1, SLC4A1)
in human red cells lacking glycophorin A.Bruce L.J., Pan R.J., Cope D.L., Uchikawa M., Gunn R.B., Cherry R.J., Tanner M.J.J. Biol. Chem. 279:2414-2420(2004)
Capsid region involved in hepatitis A virus binding to glycophorin A of the erythrocyte membrane.Sanchez G., Aragones L., Costafreda M.I., Ribes E., Bosch A., Pinto R.M.J. Virol. 78:9807-9813(2004)
Hsa, an adhesin of Streptococcus gordonii DL1, binds to alpha2-3-linked sialic acid on glycophorin A of the erythrocyte membrane.Yajima A., Urano-Tashiro Y., Shimazu K., Takashima E., Takahashi Y., Konishi K.Microbiol. Immunol. 52:69-77(2008)
Interaction of anion exchanger 1 and glycophorin A in human erythroleukaemic K562 cells.Pang A.J., Reithmeier R.A.Biochem. J. 421:345-356(2009)
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
One- and two-dimensional NMR studies of the N-terminal portion of glycophorin A at 11.7 Tesla.Dill K., Hu S.H., Berman E., Pavia A.A., Lacombe J.M.J. Protein Chem. 9:129-136(1990)
A transmembrane helix dimer
structure and implications.Mackenzie K.R., Prestegard J.H., Engelman D.M.Science 276:131-133(1997)
Improved prediction for the structure of the dimeric transmembrane domain of glycophorin A obtained through global searching.Adams P.D., Engelman D.M., Bruenger A.T.3.3.CO;2-O>Proteins 26:257-261(1996)
Molecular basis for the human erythrocyte glycophorin specifying the Miltenberger class I (MiI)
phenotype.Huang C.-H., Spruell P., Moulds J.J., Blumenfeld O.O.Blood 80:257-263(1992)
Molecular analysis of human glycophorin MiIX gene shows a silent segment transfer and untemplated mutation resulting from gene conversion via sequence repeats.Huang C.H., Skov F., Daniels G., Tippett P., Blumenfeld O.O.Blood 80:2379-2387(1992)
Alteration of splice site selection by an exon mutation in the human glycophorin A gene.Huang C.H., Reid M., Daniels G., Blumenfeld O.O.J. Biol. Chem. 268:25902-25908(1993)
Glycophorin A mutation Ala65 --> Pro gives rise to a novel pair of MNS alleles ENEP (MNS39)
and HAG (MNS41)
and altered Wrb expression
direct evidence for GPA/band 3 interaction necessary for normal Wrb expression.Poole J., Banks J., Bruce L.J., Ring S.M., Levene C., Stern H., Overbeeke M.A., Tanner M.J.Transfus. Med. 9:167-174(1999)
The low-frequency MNS blood group antigens Ny(a)
(MNS18)
and Os(a)
(MNS38)
are associated with GPA amino acid substitutions.Daniels G.L., Bruce L.J., Mawby W.J., Green C.A., Petty A., Okubo Y., Kornstad L., Tanner M.J.Transfusion 40:555-559(2000)
The MNS blood group antigens, Vr (MNS12)
and Mt(a)
(MNS14)
, each arise from an amino acid substitution on glycophorin A.Storry J.R., Coghlan G., Poole J., Figueroa D., Reid M.E.Vox Sang. 78:52-56(2000)
+Additional computationally mapped references.<p>Provides general information on the entry.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34.9 kDa
NCBI Official Full Name
glycophorin-A isoform 3
NCBI Official Synonym Full Names
glycophorin A (MNS blood group)
NCBI Official Symbol
GYPA
NCBI Official Synonym Symbols
MN; GPA; MNS; GPSAT; PAS-2; CD235a; GPErik; HGpMiV; HGpMiXI; HGpSta(C)
NCBI Protein Information
glycophorin-A
UniProt Protein Name
Glycophorin-A
UniProt Gene Name
GYPA
UniProt Synonym Gene Names
GPA
UniProt Entry Name
GLPA_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The GYPA gypa (Catalog #AAA18483) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-91aa; Extracellular Domain. The amino acid sequence is listed below: LSTTEVAMHT STSSSVTKSY ISSQTNDTHK RDTYAATPRA HEVSEISVRT VYPPEEETGE RVQLAHHFSE PE . It is sometimes possible for the material contained within the vial of "Glycophorin-A, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
