Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-DUT Polyclonal Antibody – Cat# AAA199645 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-DUT Antibody Titration: 1 ug/mlPositive Control: Fetal Small Intestine cell lysate)

Deoxyuridine 5'-Triphosphate Nucleotidohydrolase, Mitochondrial Isoform 1 (DUT) Antibody – Rabbit Polyclonal

DUT antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
DUT; dUTPase
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
DUT, Antibody; DUT antibody - N-terminal region; anti-DUT antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPK
Sequence Length
252
Applicable Applications for anti-DUT antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DUT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DUT Antibody Titration: 1 ug/mlPositive Control: Fetal Small Intestine cell lysate)

Rabbit Anti-DUT Polyclonal Antibody – Cat# AAA199645 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-DUT Antibody Titration: 1 ug/mlPositive Control: Fetal Small Intestine cell lysate)

IHC (Immunohistochemistry)

(Immunohistochemistry with Jurkat cell lysate tissue)

Rabbit Anti-DUT Polyclonal Antibody – Cat# AAA199645 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Jurkat cell lysate tissue)
Related Product Information for anti-DUT antibody
This is a rabbit polyclonal antibody against DUT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DUT is an essential enzyme of nucleotide metabolism. This protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. This gene encodes an essential enzyme of nucleotide metabolism. The encoded protein forms a ubiquitous, homotetrameric enzyme that hydrolyzes dUTP to dUMP and pyrophosphate. This reaction serves two cellular purposes: providing a precursor (dUMP) for the synthesis of thymine nucleotides needed for DNA replication, and limiting intracellular pools of dUTP. Elevated levels of dUTP lead to increased incorporation of uracil into DNA, which induces extensive excision repair mediated by uracil glycosylase. This repair process, resulting in the removal and reincorporation of dUTP, is self-defeating and leads to DNA fragmentation and cell death. Alternative splicing of this gene leads to different isoforms that localize to either the mitochondrion or nucleus. A related pseudogene is located on chromosome 19.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial isoform 1
NCBI Official Synonym Full Names
deoxyuridine triphosphatase
NCBI Official Symbol
DUT
NCBI Official Synonym Symbols
dUTPase
NCBI Protein Information
deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
UniProt Protein Name
Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
UniProt Gene Name
DUT
UniProt Synonym Gene Names
dUTPase
UniProt Entry Name
DUT_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The DUT dut (Catalog #AAA199645) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DUT antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DUT can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the DUT dut for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAVLSGPGPP LGRAAQHGIP RPLSSAGRLS QGCRGASTVG AAGWKGELPK. It is sometimes possible for the material contained within the vial of "DUT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.