Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28262_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ?g extracts of HeLa cells using 3 ?g DBI antibody (AAA28262). Western blot was performed from the immunoprecipitate using DBI antibody (AAA28262) at a dilution of 1:1000.)

Rabbit DBI Polyclonal Antibody | anti-DBI antibody

DBI Polyclonal Antibody

Gene Names
DBI; EP; ACBP; ACBD1; CCK-RP
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunocytochemistry, Immunoprecipitation, ELISA
Purity
Affinity Purification
Synonyms
DBI, Antibody; DBI Polyclonal Antibody; ACBD1; ACBP; CCK-RP; EP; anti-DBI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Sequence Length
87
Applicable Applications for anti-DBI antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA
Application Notes
WB: 1:500 - 1:1000
IHC-P: 1:50 - 1:200
IF/ICC: 1:50 - 1:200
IP: 0.5 ug- 4 ug antibody for 200 ug- 400 ug extracts of whole cells
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-104 of human DBI (NP_001171513.1).
Preparation and Storage
Store at -20°C. Avoid freeze / thaw cycles.

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300 ?g extracts of HeLa cells using 3 ?g DBI antibody (AAA28262). Western blot was performed from the immunoprecipitate using DBI antibody (AAA28262) at a dilution of 1:1000.)

product-image-AAA28262_IP13.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300 ?g extracts of HeLa cells using 3 ?g DBI antibody (AAA28262). Western blot was performed from the immunoprecipitate using DBI antibody (AAA28262) at a dilution of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of U2OS cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28262_IF12.jpg IF (Immunofluorescence) (Immunofluorescence analysis of U2OS cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28262_IF11.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28262_IF10.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A-549 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

product-image-AAA28262_IF9.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A-549 cells using DBI Rabbit pAb (AAA28262) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of DBI in paraffin-embedded rat ovary using DBI Rabbit pAb (AAA28262) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28262_IHC8.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of DBI in paraffin-embedded rat ovary using DBI Rabbit pAb (AAA28262) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of DBI in paraffin-embedded rat liver using DBI Rabbit pAb (AAA28262) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28262_IHC7.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of DBI in paraffin-embedded rat liver using DBI Rabbit pAb (AAA28262) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of various lysates using DBI Rabbit pAb (AAA28262) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

product-image-AAA28262_WB6.jpg WB (Western Blot) (Western blot analysis of various lysates using DBI Rabbit pAb (AAA28262) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 180s.)

WB (Western Blot)

(Western blot analysis of various lysates using DBI Rabbit pAb (AAA28262) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic KitExposure time: 1s.)

product-image-AAA28262_WB5.jpg WB (Western Blot) (Western blot analysis of various lysates using DBI Rabbit pAb (AAA28262) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic KitExposure time: 1s.)

IF (Immunofluorescence)

(Immunofluorescence analysis of MCF-7 cells using DBI antibody. Blue: DAPI for nuclear staining.)

product-image-AAA28262_IF4.jpg IF (Immunofluorescence) (Immunofluorescence analysis of MCF-7 cells using DBI antibody. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse brain using DBI Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28262_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse brain using DBI Antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human prostate using DBI Antibody at dilution of 1:100 (40x lens).)

product-image-AAA28262_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human prostate using DBI Antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using DBI antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA28262_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using DBI antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-DBI antibody
This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-DBI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 10kDa
Observed: 11kDa
NCBI Official Full Name
acyl-CoA-binding protein isoform 3
NCBI Official Synonym Full Names
diazepam binding inhibitor, acyl-CoA binding protein
NCBI Official Symbol
DBI
NCBI Official Synonym Symbols
EP; ACBP; ACBD1; CCK-RP
NCBI Protein Information
acyl-CoA-binding protein
UniProt Protein Name
Acyl-CoA-binding protein
UniProt Gene Name
DBI
UniProt Synonym Gene Names
ACBP; DBI; EP

Similar Products

Product Notes

The DBI dbi (Catalog #AAA28262) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DBI Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DBI can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), ICC (Immunocytochemistry), IP (Immunoprecipitation), ELISA. WB: 1:500 - 1:1000 IHC-P: 1:50 - 1:200 IF/ICC: 1:50 - 1:200 IP: 0.5 ug- 4 ug antibody for 200 ug- 400 ug extracts of whole cells. Researchers should empirically determine the suitability of the DBI dbi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MWGDLWLLPP ASANPGTGTE AEFEKAAEEV RHLKTKPSDE EMLFIYGHYK QATVGDINTE RPGMLDFTGK AKWDAWNELK GTSKEDAMKA YINKVEELKK KYGI. It is sometimes possible for the material contained within the vial of "DBI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.