Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-DBI Polyclonal Antibody – Cat# AAA197534 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-DBI Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Acyl-Coa-Binding Protein Isoform 3 (DBI) Antibody – Rabbit Polyclonal

DBI antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
DBI; EP; ACBP; ACBD1; CCK-RP
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
DBI, Antibody; DBI antibody - N-terminal region; anti-DBI antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF
Sequence Length
87
Applicable Applications for anti-DBI antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DBI
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-DBI Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Rabbit Anti-DBI Polyclonal Antibody – Cat# AAA197534 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-DBI Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

WB (Western Blot)

(Host: RabbitTarget Name: DBISample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Rabbit Anti-DBI Polyclonal Antibody – Cat# AAA197534 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: DBISample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: DBISample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Rabbit Anti-DBI Polyclonal Antibody – Cat# AAA197534 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: DBISample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-DBI antibody)

Rabbit Anti-DBI Polyclonal Antibody – Cat# AAA197534 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-DBI antibody)
Related Product Information for anti-DBI antibody
This is a rabbit polyclonal antibody against DBI. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
acyl-CoA-binding protein isoform 3
NCBI Official Synonym Full Names
diazepam binding inhibitor, acyl-CoA binding protein
NCBI Official Symbol
DBI
NCBI Official Synonym Symbols
EP; ACBP; ACBD1; CCK-RP
NCBI Protein Information
acyl-CoA-binding protein
UniProt Protein Name
Acyl-CoA-binding protein
UniProt Gene Name
DBI
UniProt Synonym Gene Names
ACBP; DBI; EP
UniProt Entry Name
ACBP_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The DBI dbi (Catalog #AAA197534) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DBI antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DBI can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the DBI dbi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF. It is sometimes possible for the material contained within the vial of "DBI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.