Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – IF (Immunofluorescence) IF (Immunofluorescence) (Rabbit Anti-RTCB AntibodyCatalog Number: AAA23572Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3bSecondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec.)

Trna-Splicing Ligase Rtcb Homolog (RTCB) Antibody – Rabbit Polyclonal

C22orf28 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
RTCB; FAAP; HSPC117; C22orf28; DJ149A16.6
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
C22orf28, Antibody; C22orf28 antibody - N-terminal region; FAAP, HSPC117, C22orf28, DJ149A16.6; anti-RTCB antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/mL (varies by lot)
Sequence
Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
Sequence Length
505
Applicable Applications for anti-RTCB antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf28
Protein Size (# AA)
505 amino acids
Protein Interactions
UBC; FUS; SUMO1; NEDD8; MDM2; BMI1; rev; HNRNPM; MRE11A; KRT18; ILF2; FLII; DHX9; DDX1; ABCF1; C14orf166; RPL26L1; IGF2BP3; POLR1C; LRRFIP1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; PRKDC; NMT1; AICDA; FN1; CA9; FAM98B; C2orf49; CAND1; COPS5; CUL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

IF (Immunofluorescence)

(Rabbit Anti-RTCB AntibodyCatalog Number: AAA23572Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3bSecondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec.)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – IF (Immunofluorescence) IF (Immunofluorescence) (Rabbit Anti-RTCB AntibodyCatalog Number: AAA23572Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue Observed Staining: CytoplasmicPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3bSecondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec.)

WB (Western Blot)

(25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be modified by phosphorylation.)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – WB (Western Blot) WB (Western Blot) (25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be modified by phosphorylation.)

WB (Western Blot)

(WB Suggested Anti-C22orf28 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-C22orf28 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: C22orf28Sample Type: JurkatAntibody Dilution: 1.0ug/mlRTCB is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: C22orf28Sample Type: JurkatAntibody Dilution: 1.0ug/mlRTCB is supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: C22orf28Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: C22orf28Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: C22orf28Sample Type: HelaAntibody Dilution: 1.0ug/mlRTCB is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: C22orf28Sample Type: HelaAntibody Dilution: 1.0ug/mlRTCB is supported by BioGPS gene expression data to be expressed in HeLa)

WB (Western Blot)

(Host: RabbitTarget Name: C22orf28Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: C22orf28Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-C22orf28 antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 10 ug/ml)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-C22orf28 antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 10 ug/ml)

IHC (Immunohistochemistry)

(Rabbit Anti-C22orf28 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 10 ug/ml)

Rabbit Anti-RTCB Polyclonal Antibody – Cat# AAA23572 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-C22orf28 antibodyFormalin Fixed Paraffin Embedded Tissue: Human ColonPrimary antibody Concentration: 10 ug/ml)
Related Product Information for anti-RTCB antibody
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-RTCB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
tRNA-splicing ligase RtcB homolog
NCBI Official Synonym Full Names
RNA 2',3'-cyclic phosphate and 5'-OH ligase
NCBI Official Symbol
RTCB
NCBI Official Synonym Symbols
FAAP; HSPC117; C22orf28; DJ149A16.6
NCBI Protein Information
tRNA-splicing ligase RtcB homolog
UniProt Protein Name
tRNA-splicing ligase RtcB homolog
UniProt Gene Name
RTCB

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The RTCB rtcb (Catalog #AAA23572) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C22orf28 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's C22orf28 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the RTCB rtcb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PEAVVSPGGV GFDINCGVRL LRTNLDESDV QPVKEQLAQA MFDHIPVGVG. It is sometimes possible for the material contained within the vial of "C22orf28, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.