Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-ADSL Polyclonal Antibody – Cat# AAA200977 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ADSL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Adenylosuccinate Lyase Isoform A (ADSL) Antibody – Rabbit Polyclonal

ADSL antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ADSL; ASL; AMPS; ASASE
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ADSL, Antibody; ADSL antibody - middle region; anti-ADSL antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVRDDLRFRGVKGTTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFI
Sequence Length
484
Applicable Applications for anti-ADSL antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 93%; Rat: 86%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADSL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ADSL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

Rabbit Anti-ADSL Polyclonal Antibody – Cat# AAA200977 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-ADSL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Muscle)

WB (Western Blot)

(Host: RabbitTarget Name: ADSLSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Rabbit Anti-ADSL Polyclonal Antibody – Cat# AAA200977 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: ADSLSample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Sample Type: HumanSample Type: 1. Hamster CHO K1 cells (20ug)2. HeLa skin cells(100ug)3. HEK273 cells (100ug)4. HepG2 cells (100ug)5. purified human ADSL protein (40ng)Primary Dilution: 1:2000Secondary Antibody: Clean-Blot IP detection Reagent and KitSecondary Dilution: 1:2000Image Submitted By: V. Skopova, M. ZikanovaInstitute of Inherited Metabolic Disorders, Charles University in Prague and General Hopspital in Prague )

Rabbit Anti-ADSL Polyclonal Antibody – Cat# AAA200977 – WB (Western Blot) WB (Western Blot) (Sample Type: HumanSample Type: 1. Hamster CHO K1 cells (20ug)2. HeLa skin cells(100ug)3. HEK273 cells (100ug)4. HepG2 cells (100ug)5. purified human ADSL protein (40ng)Primary Dilution: 1:2000Secondary Antibody: Clean-Blot IP detection Reagent and KitSecondary Dilution: 1:2000Image Submitted By: V. Skopova, M. ZikanovaInstitute of Inherited Metabolic Disorders, Charles University in Prague and General Hopspital in Prague )

IHC (Immunohistochemistry)

(Rabbit Anti-ADSL AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in endothelial cells in blood vesselsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit Anti-ADSL Polyclonal Antibody – Cat# AAA200977 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Rabbit Anti-ADSL AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: Cytoplasmic in endothelial cells in blood vesselsPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ADSL antibody
This is a rabbit polyclonal antibody against ADSL. It was validated on Western Blot

Target Description: Adenylsuccinate lyase is involved in both de novo synthesis of purines and formation of adenosine monophosphate from inosine monophosphate. It catalyzes two reactions in AMP biosynthesis: the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to give aminoimidazole carboxamide ribotide (AICA) and removal of fumarate from adenylosuccinate to give AMP. Adenylosuccinase deficiency results in succinylpurinemic autism, psychomotor retardation, and, in some cases, growth retardation associated with muscle wasting and epilepsy. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
158
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
adenylosuccinate lyase isoform a
NCBI Official Synonym Full Names
adenylosuccinate lyase
NCBI Official Symbol
ADSL
NCBI Official Synonym Symbols
ASL; AMPS; ASASE
NCBI Protein Information
adenylosuccinate lyase
UniProt Protein Name
Adenylosuccinate lyase
UniProt Gene Name
ADSL
UniProt Synonym Gene Names
AMPS; ASL; ASase
UniProt Entry Name
PUR8_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ADSL adsl (Catalog #AAA200977) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADSL antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ADSL can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ADSL adsl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVRDDLRFRG VKGTTGTQAS FLQLFEGDDH KVEQLDKMVT EKAGFKRAFI. It is sometimes possible for the material contained within the vial of "ADSL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.