Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Mouse Anti-FOXA1 Monoclonal Antibody – Cat# AAA330105 – WB (Western Blot) WB (Western Blot) (Western blot analysis of extracts from various samples, using FOXA1 Mouse Monoclonal Antibody. Lane 1: Hela cells treated with blocking-peptides, Lane 2: Hela cells, Lane 3: MCF7 cells.)

FOXA1 (FOXA1) Antibody – Mouse Monoclonal

FOXA1 Mouse Monoclonal Antibody

Average rating 0.0
No ratings yet
Reactivity
Human
Prediction: Pig, Zebrafish, Bovine, Sheep, Chicken, Xenopus
Applications
Western Blot
Purity
Affinity-chromatography.
Synonyms
FOXA1, Antibody; FOXA1 Mouse Monoclonal Antibody; forkhead box A1; Forkhead box protein A1; FOX A1; FOXA1; FOXA1_HUMAN; hepatocyte nuclear factor 3 alpha; Hepatocyte nuclear factor 3-alpha; HNF 3A; HNF-3-alpha; HNF-3A; HNF3A; MGC33105; TCF 3A; TCF-3A; TCF3A; Transcription factor 3A; anti-FOXA1 antibody
Ordering

Product Overview

Host
Mouse
Reactivity
Human
Prediction: Pig, Zebrafish, Bovine, Sheep, Chicken, Xenopus
Clonality
Monoclonal
Isotype
Mouse IgG1
Specificity
FOXA1 Antibody detects endogenous levels of total FOXA1.
Purity/Purification
Affinity-chromatography.
Form/Format
Mouse IgG1 in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Sequence
MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPGAVAGMPGGSAGAMNSMTAAGVTAMGTALSPSGMGAMGAQQAASMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGGGSGSGGSGAKGGPESRKDPSGASNPSADSPLHRGVHGKTGQLEGAPAPGPAASPQTLDHSGATATGGASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Applicable Applications for anti-FOXA1 antibody
WB (Western Blot)
Immunogen
A synthesized peptide derived from human FOXA1(Accession P55317), corresponding to amino acid residues V444-S472.
Conjugation
Unconjugated
Expression
Highly expressed in prostate and ESR1-positive breast tumors. Overexpressed in esophageal and lung adenocarcinomas.
Preparation and Storage
Store at -20 degree C. Stable for 12 months from date of receipt.

WB (Western Blot)

(Western blot analysis of extracts from various samples, using FOXA1 Mouse Monoclonal Antibody. Lane 1: Hela cells treated with blocking-peptides, Lane 2: Hela cells, Lane 3: MCF7 cells.)

Mouse Anti-FOXA1 Monoclonal Antibody – Cat# AAA330105 – WB (Western Blot) WB (Western Blot) (Western blot analysis of extracts from various samples, using FOXA1 Mouse Monoclonal Antibody. Lane 1: Hela cells treated with blocking-peptides, Lane 2: Hela cells, Lane 3: MCF7 cells.)

WB (Western Blot)

(Western blot analysis of extracts from rat liver tissue, using FOXA1 Mouse Monoclonal Antibody. The lane on the left was treated with blocking-peptides.)

Mouse Anti-FOXA1 Monoclonal Antibody – Cat# AAA330105 – WB (Western Blot) WB (Western Blot) (Western blot analysis of extracts from rat liver tissue, using FOXA1 Mouse Monoclonal Antibody. The lane on the left was treated with blocking-peptides.)
Product Categories/Family for anti-FOXA1 antibody

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
43~50kD; 49kD(Calculated)

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The FOXA1 (Catalog #AAA330105) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FOXA1 Mouse Monoclonal Antibody reacts with Human Prediction: Pig, Zebrafish, Bovine, Sheep, Chicken, Xenopus and may cross-react with other species as described in the data sheet. AAA Biotech's FOXA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the FOXA1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLGTVKMEGH ETSDWNSYYA DTQEAYSSVP VSNMNSGLGS MNSMNTYMTM NTMTTSGNMT PASFNMSYAN PGLGAGLSPG AVAGMPGGSA GAMNSMTAAG VTAMGTALSP SGMGAMGAQQ AASMNGLGPY AAAMNPCMSP MAYAPSNLGR SRAGGGGDAK TFKRSYPHAK PPYSYISLIT MAIQQAPSKM LTLSEIYQWI MDLFPYYRQN QQRWQNSIRH SLSFNDCFVK VARSPDKPGK GSYWTLHPDS GNMFENGCYL RRQKRFKCEK QPGAGGGGGS GSGGSGAKGG PESRKDPSGA SNPSADSPLH RGVHGKTGQL EGAPAPGPAA SPQTLDHSGA TATGGASELK TPASSTAPPI SSGPGALASV PASHPAHGLA PHESQLHLKG DPHYSFNHPF SINNLMSSSE QQHKLDFKAY EQALQYSPYG STLPASLPLG SASVTTRSPI EPSALEPAYY QGVYSRPVLN TS. It is sometimes possible for the material contained within the vial of "FOXA1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.