Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA125915_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (AAA125915).Fibrinogen beta chain/FGB was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Fibrinogen beta chain/FGB Antibody (AAA125915) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

Mouse anti-Human Fibrinogen beta chain/FGB Monoclonal Antibody | anti-FGB antibody

Anti-Fibrinogen beta chain/FGB Antibody (monoclonal, 6D12)

Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Fibrinogen beta chain/FGB, Antibody; Anti-Fibrinogen beta chain/FGB Antibody (monoclonal, 6D12); FGB; Fibrinogen beta chain; Fibrinopeptide B; fibrinogen beta chain; anti-FGB antibody
Ordering
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
Mouse IgG2b
Clone Number
6D12
Specificity
Mouse IgG monoclonal antibody for Fibrinogen beta chain/FGB detection.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized. Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Applicable Applications for anti-FGB antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems
Recommended Detection Systems
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Figure 2. IHC analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (AAA125915).Fibrinogen beta chain/FGB was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Fibrinogen beta chain/FGB Antibody (AAA125915) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

product-image-AAA125915_IHC13.jpg IHC (Immunohiostchemistry) (Figure 2. IHC analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (AAA125915).Fibrinogen beta chain/FGB was detected in paraffin-embedded section of human liver cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH8. 0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml mouse anti-Fibrinogen beta chain/FGB Antibody (AAA125915) overnight at 4 degree C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37 degree C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.)

WB (Western Blot)

(Figure 1. Western blot analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (AAA125915).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HEPG2 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- Fibrinogen beta chain/FGB antigen affinity purified monoclonal antibody (Catalog # AAA125915) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Fibrinogen beta chain/FGB at approximately 56KD. The expected band size for Fibrinogen beta chain/FGB is at 56KD.)

product-image-AAA125915_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of Fibrinogen beta chain/FGB using anti-Fibrinogen beta chain/FGB antibody (AAA125915).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human HEPG2 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with mouse anti- Fibrinogen beta chain/FGB antigen affinity purified monoclonal antibody (Catalog # AAA125915) at 0. 5 μg/mL overnight at 4 degree C, then washed with TBS-0. 1%Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1. 5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Fibrinogen beta chain/FGB at approximately 56KD. The expected band size for Fibrinogen beta chain/FGB is at 56KD.)
Related Product Information for anti-FGB antibody
Fibrinogen beta chain, mapped to 4q31. 3, is also known as FGB. The protein encoded by this gene is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: FGB fibrinogen beta chain".
2. Chung, D. W., Que, B. G., Rixon, M. W., Mace, M., Jr., Davie, E. W. Characterization of complementary deoxyribonucleic acid and genomic deoxyribonucleic acid for the beta chain of human fibrinogen. Biochemistry 22: 3244-3250, 1983.
3. Spena, S., Duga, S., Asselta, R., Malcovati, M., Peyvandi, F., Tenchini, M. L. Congenital afibrinogenemia: first identification of splicing mutations in the fibrinogen B-beta-chain gene causing activation of cryptic splice sites. Blood 100: 4478-4484, 2002.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,928 Da
NCBI Official Full Name
fibrinogen beta chain isoform 2 preproprotein
NCBI Official Synonym Full Names
fibrinogen beta chain
NCBI Official Symbol
FGB
NCBI Protein Information
fibrinogen beta chain; fibrinogen, B beta polypeptide
UniProt Protein Name
Fibrinogen beta chain
UniProt Gene Name
FGB
UniProt Entry Name
FIBB_HUMAN

Similar Products

Product Notes

The FGB fgb (Catalog #AAA125915) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Anti-Fibrinogen beta chain/FGB Antibody (monoclonal, 6D12) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Fibrinogen beta chain/FGB can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the FGB fgb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Fibrinogen beta chain/FGB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.