Matrix Metalloproteinase-9 Preproprotein (MMP9) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Matrix metalloproteinase-9 (MMP9) , partial
Gene Names
MMP9; GELB; CLG4B; MMP-9; MANDP2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Matrix metalloproteinase-9 (MMP9); N/A; Recombinant Human Matrix metalloproteinase-9 (MMP9) , partial; MMP9 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
47-358aa
Sequence
FQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Sequence Length
707
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for MMP9 recombinant protein
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP s are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The enzyme encoded by this gene degrades type IV and V collagens. Studies in rhesus monkeys suggest that the enzyme is involved in IL-8-induced mobilization of hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling.
Product Categories/Family for MMP9 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
68.6 kDa
NCBI Official Full Name
matrix metalloproteinase-9 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 9
NCBI Official Symbol
MMP9
NCBI Official Synonym Symbols
GELB; CLG4B; MMP-9; MANDP2
NCBI Protein Information
matrix metalloproteinase-9
UniProt Protein Name
Matrix metalloproteinase-9
UniProt Gene Name
MMP9
UniProt Synonym Gene Names
CLG4B; MMP-9; GELB
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The MMP9 mmp9 (Catalog #AAA81658) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 47-358aa. The amino acid sequence is listed below: FQTFEGDLKW HHHNITYWIQ NYSEDLPRAV IDDAFARAFA LWSAVTPLTF TRVYSRDADI VIQFGVAEHG DGYPFDGKDG LLAHAFPPGP GIQGDAHFDD DELWSLGKGV VVPTRFGNAD GAACHFPFIF EGRSYSACTT DGRSDGLPWC STTANYDTDD RFGFCPSERL YTQDGNADGK PCQFPFIFQG QSYSACTTDG RSDGYRWCAT TANYDRDKLF GFCPTRADST VMGGNSAGEL CVFPFTFLGK EYSTCTSEGR GDGRLWCATT SNFDSDKKWG FCPDQGYSLF LVAAHEFGHA LGLDHSSVPE ALMYPMYRFT EGPPLHKDDV NGIRHLYGPR PEPEPRPPTT TTPQPTAPPT VCPTGPPTVH PSERPTAGPT GPPSAGPTGP PTAGPSTATT VPLSPVDDAC NVNIFDAIAE IGNQLYLFKD GKYWRFSEGR GSRPQGPFLI ADKWPALPRK LDSVFEERLS KKLFFFSGRQ VWVYTGASVL GPRRLDKLGL GADVAQVTGA LRSGRGKMLL FSGRRLWRFD VKAQMVDPRS ASEVDRMFPG VPLDTHDVFQ YREKAYFCQD RFYWRVSSRS ELNQVDQVGY VTYDILQCPE D. It is sometimes possible for the material contained within the vial of "Matrix metalloproteinase-9 (MMP9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
