Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell Cd3e\r Recombinant Protein – Cat# AAA113337 – SDS-PAGE SDS-PAGE

T-Cell Surface Glycoprotein CD3 Epsilon Chain (Cd3e\r) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial

Average rating 0.0
No ratings yet
Gene Names
Cd3e; CD3; T3e; AI504783; CD3epsilon
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
T-cell surface glycoprotein CD3 epsilon chain (Cd3e); N/A; Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain (Cd3e), partial; Cd3e\r recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-108aa; Extracellular Domain
Sequence
DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Sequence Length
189
Species
Mouse
Production Note
Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell Cd3e\r Recombinant Protein – Cat# AAA113337 – SDS-PAGE SDS-PAGE
Related Product Information for Cd3e\r recombinant protein
This protein is the CD3-epsilon polypeptide, which together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha
beta and gamma
delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. The epsilon polypeptide plays an essential role in T-cell development. Defects in this gene cause immunodeficiency. This gene has also been linked to a susceptibility to type I diabetes in women.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.9 kDa
NCBI Official Full Name
T-cell surface glycoprotein CD3 epsilon chain
NCBI Official Synonym Full Names
CD3 antigen, epsilon polypeptide
NCBI Official Symbol
Cd3e
NCBI Official Synonym Symbols
CD3; T3e; AI504783; CD3epsilon
NCBI Protein Information
T-cell surface glycoprotein CD3 epsilon chain
UniProt Protein Name
T-cell surface glycoprotein CD3 epsilon chain
UniProt Gene Name
Cd3e

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The Cd3er cd3e (Catalog #AAA113337) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-108aa; Extracellular Domain. The amino acid sequence is listed below: DAENIEYKVS ISGTSVELTC PLDSDENLKW EKNGQELPQK HDKHLVLQDF SEVEDSGYYV CYTPASNKNT YLYLKARVCE YCVEVD. It is sometimes possible for the material contained within the vial of "T-cell surface glycoprotein CD3 epsilon chain (Cd3e), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.