Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell UL111A Recombinant Protein – Cat# AAA115741 – SDS-PAGE SDS-PAGE

Viral Interleukin-10 Homolog (UL111A) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) Viral interleukin-10 homolog

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Viral interleukin-10 homolog; N/A; Recombinant Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5) Viral interleukin-10 homolog; cmvIL-10; vIL-10; UL111A recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
20-175aa; Full Length
Sequence
SEEAKPATTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK
Sequence Length
175
Species
Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell UL111A Recombinant Protein – Cat# AAA115741 – SDS-PAGE SDS-PAGE
Related Product Information for UL111A recombinant protein
Functional viral IL-10 homolog. Can bind to the human IL-10 receptor and compete with human IL-10 for binding sites. Requires both subunits of the human IL-10 receptor complex to induce signal transduction events and biological activities. IL-10 signaling pathway has several immunosuppressive activities that are exploited by the virus. Inhibits TLR-induced type I interferon production in host plasmacytoid dendritic cells.
References
"Human cytomegalovirus-encoded interleukin-10 homolog inhibits maturation of dendritic cells and alters their functionality." Chang W.L., Baumgarth N., Yu D., Barry P.A. J. Virol. 78:8720-8731(2004)

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
34 kDa
NCBI Official Full Name
Viral interleukin-10 homolog
UniProt Protein Name
Viral interleukin-10 homolog
UniProt Gene Name
UL111A
UniProt Synonym Gene Names
cmvIL-10; vIL-10
UniProt Entry Name
IL10H_HCMVA

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The UL111A ul111a (Catalog #AAA115741) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 20-175aa; Full Length. The amino acid sequence is listed below: SEEAKPATTT IKNTKPQCRP EDYATRLQDL RVTFHRVKPT LQREDDYSVW LDGTVVKGCW GCSVMDWLLR RYLEIVFPAG DHVYPGLKTE LHSMRSTLES IYKDMRQCPL LGCGDKSVIS RLSQEAERKS DNGTRKGLSE LDTLFSRLEE YLHSRK. It is sometimes possible for the material contained within the vial of "Viral interleukin-10 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.