Cellular tumor antigen p53 Recombinant Protein | Tp53 recombinant protein

Recombinant Rat Cellular tumor antigen p53 protein

Cat. Num. AAA116137

• Gene Names: Tp53; p53; Trp53
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cellular tumor antigen p53; N/A; Recombinant Rat Cellular tumor antigen p53 protein; Tumor suppressor p53; Tp53 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-391aa; Full Length
• Sequence: MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFLPQDVAELLEGPEEALQVSAPAAQEPGTEAPAPVAPASATPWPLSSSVPSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWVTSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSDGDGLAPPQHLIRVEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHCPELPPGSAKRALPTSTSSSPQQKKKPLDGEYFTLKIRGRERFEMFRELNEALELKDARAAEESGDSRAHSSYPKTKKGQSTSRHKKPMIKKVGPDSD

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Tp53 recombinant protein

Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction ses to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and se to have to effect on cell-cycle regulation. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2.

References

Nucleotide sequence of a cDNA encoding the rat p53 nuclear oncoprotein.Soussi T.Nucleic Acids Res. 16:11384-11384(1988) Structure of the rat p53 tumor suppressor gene.Hulla J.E., Schneider R.P.Nucleic Acids Res. 21:713-717(1993) Glucose catabolism in cancer cells. The type II hexokinase promoter contains functionally active response elements for the tumor suppressor p53.Mathupala S.P., Heese C., Pedersen P.L.J. Biol. Chem. 272:22776-22780(1997) Heat shock protein 84 forms a complex with mutant p53 protein predominantly within a cytoplasmic compartment of the cell.Sepehrnia B., Paz I.B., Dasgupta G., Momand J.J. Biol. Chem. 271:15084-15090(1996) p53 opens the mitochondrial permeability transition pore to trigger necrosis.Vaseva A.V., Marchenko N.D., Ji K., Tsirka S.E., Holzmann S., Moll U.M.Cell 149:1536-1548(2012)

NCBI and Uniprot Product Information

• NCBI GI #: 189083686
• NCBI GeneID: 24842
• NCBI Accession #: NP_112251.2
• NCBI GenBank Nucleotide #: NM_030989.3
• UniProt Accession #: P10361; O09168; Q4KMA9; Q66HM0
• Molecular Weight: 47.5 kDa
• NCBI Official Full Name: cellular tumor antigen p53
• NCBI Official Synonym Full Names: tumor protein p53
• NCBI Official Symbol: Tp53
• NCBI Official Synonym Symbols: p53; Trp53
• NCBI Protein Information: cellular tumor antigen p53
• UniProt Protein Name: Cellular tumor antigen p53
• UniProt Gene Name: Tp53
• UniProt Synonym Gene Names: P53
• UniProt Entry Name: P53_RAT