Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell Timp3 Recombinant Protein – Cat# AAA113194 – SDS-PAGE SDS-PAGE

Metalloproteinase Inhibitor 3 (Timp3) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Mouse Metalloproteinase inhibitor 3 (Timp3)

Average rating 0.0
No ratings yet
Gene Names
Timp3; Timp-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Metalloproteinase inhibitor 3 (Timp3); N/A; Recombinant Mouse Metalloproteinase inhibitor 3 (Timp3); Timp3 recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
24-211aa; Full Length of Mature Protein
Sequence
CTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSISNATDP
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell Timp3 Recombinant Protein – Cat# AAA113194 – SDS-PAGE SDS-PAGE
Related Product Information for Timp3 recombinant protein
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby s fundus dystrophy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,182 Da
NCBI Official Full Name
metalloproteinase inhibitor 3
NCBI Official Synonym Full Names
tissue inhibitor of metalloproteinase 3
NCBI Official Symbol
Timp3
NCBI Official Synonym Symbols
Timp-3
NCBI Protein Information
metalloproteinase inhibitor 3
UniProt Protein Name
Metalloproteinase inhibitor 3
UniProt Gene Name
Timp3
UniProt Synonym Gene Names
Sun; Timp-3; TIMP-3

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The Timp3 timp3 (Catalog #AAA113194) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-211aa; Full Length of Mature Protein. The amino acid sequence is listed below: CTCSPSHPQD AFCNSDIVIR AKVVGKKLVK EGPFGTLVYT IKQMKMYRGF SKMPHVQYIH TEASESLCGL KLEVNKYQYL LTGRVYEGKM YTGLCNFVER WDHLTLSQRK GLNYRYHLGC NCKIKSCYYL PCFVTSKNEC LWTDMLSNFG YPGYQSKHYA CIRQKGGYCS WYRGWAPPDK SISNATDP. It is sometimes possible for the material contained within the vial of "Metalloproteinase inhibitor 3 (Timp3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.