Transcription elongation factor B polypeptide 1 Recombinant Protein | TCEB1 recombinant protein

Recombinant Human Transcription elongation factor B polypeptide 1

Cat. Num. AAA116198

• Gene Names: TCEB1; SIII; eloC
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Transcription elongation factor B polypeptide 1; N/A; Recombinant Human Transcription elongation factor B polypeptide 1; Elongin 15 kDa subunit; Elongin-C; EloCRNA polymerase II transcription factor SIII subunit CSIII p15; TCEB1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-112. Full-length.
• Sequence: MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for TCEB1 recombinant protein

SIII, also known as elongin, is a general transcription elongation factor that increases the RNA polymerase II transcription elongation past template-encoded arresting sites. Subunit A is transcriptionally active and its transcription activity is strongly enhanced by binding to the dimeric complex of the SIII regulatory subunits B and C (elongin BC complex).

Product Categories/Family for TCEB1 recombinant protein

Immunology

References

A human cDNA encoding the small subunit of RNA polymerase II transcription factor SIII.Garrett K.P., Haque D., Conaway R.C., Conaway J.W.Gene 150:413-414(1994) The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007) DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335(2006) Drosophila von Hippel-Lindau tumor suppressor complex possesses E3 ubiquitin ligase activity.Aso T., Yamazaki K., Aigaki T., Kitajima S.Biochem. Biophys. Res. Commun. 276:355-361(2000) Amplification and overexpression of Elongin C gene discovered in prostate cancer by cDNA microarrays.Porkka K., Saramaeki O., Tanner M., Visakorpi T.Lab. Invest. 82:629-637(2002) Phosphorylation of a novel SOCS-box regulates assembly of the HIV-1 Vif-Cul5 complex that promotes APOBEC3G degradation.Mehle A., Goncalves J., Santa-Marta M., McPike M., Gabuzda D.Genes Dev. 18:2861-2866(2004) TMF/ARA160 is a BC-box-containing protein that mediates the degradation of Stat3.Perry E., Tsruya R., Levitsky P., Pomp O., Taller M., Weisberg S., Parris W., Kulkarni S., Malovani H., Pawson T., Shpungin S., Nir U.Oncogene 23:8908-8919(2004) Suppressors of cytokine signaling 4 and 5 regulate epidermal growth factor receptor signaling.Kario E., Marmor M.D., Adamsky K., Citri A., Amit I., Amariglio N., Rechavi G., Yarden Y.J. Biol. Chem. 280:7038-7048(2005) Structural basis for protein recognition by B30.2/SPRY domains.Woo J.S., Suh H.Y., Park S.Y., Oh B.H.Mol. Cell 24:967-976(2006) Respiratory syncytial virus NS1 protein degrades STAT2 by using the Elongin-Cullin E3 ligase.Elliott J., Lynch O.T., Suessmuth Y., Qian P., Boyd C.R., Burrows J.F., Buick R., Stevenson N.J., Touzelet O., Gadina M., Power U.F., Johnston J.A.J. Virol. 81:3428-3436(2007) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011) The Kelch repeat protein KLHDC10 regulates oxidative stress-induced ASK1 activation by suppressing PP5.Sekine Y., Hatanaka R., Watanabe T., Sono N., Iemura S., Natsume T., Kuranaga E., Miura M., Takeda K., Ichijo H.Mol. Cell 48:692-704(2012) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014) Structure of the VHL-ElonginC-ElonginB complex implications for VHL tumor suppressor function.Stebbins C.E., Kaelin W.G. Jr., Pavletich N.P.Science 284:455-461(1999) Structural basis for the recognition of hydroxyproline in HIF-1 alpha by pVHL.Hon W.-C., Wilson M.I., Harlos K., Claridge T.D.W., Schofield C.J., Pugh C.W., Maxwell P.H., Ratcliffe P.J., Stuart D.I., Jones E.Y.Nature 417:975-978(2002) Structure of an HIF-1alpha-pVHL complex hydroxyproline recognition in signaling.Min J.-H., Yang H., Ivan M., Gertler F., Kaelin W.G. Jr., Pavletich N.P.Science 296:1886-1889(2002) Structure of the SOCS4-ElonginB/C complex reveals a distinct SOCS box interface and the molecular basis for SOCS-dependent EGFR degradation.Bullock A.N., Rodriguez M.C., Debreczeni J.E., Songyang Z., Knapp S.Structure 15:1493-1504(2007)

NCBI and Uniprot Product Information

• NCBI GI #: 325652033
• NCBI GeneID: 6921
• NCBI Accession #: NP_001191786.1
• NCBI GenBank Nucleotide #: NM_001204857.1
• UniProt Accession #: Q15369; Q567Q6; E5RGD9
• Molecular Weight: 39.5 kDa
• NCBI Official Full Name: transcription elongation factor B polypeptide 1 isoform a
• NCBI Official Synonym Full Names: transcription elongation factor B (SIII), polypeptide 1 (15kDa, elongin C)
• NCBI Official Symbol: TCEB1
• NCBI Official Synonym Symbols: SIII; eloC
• NCBI Protein Information: transcription elongation factor B polypeptide 1
• UniProt Protein Name: Transcription elongation factor B polypeptide 1
• UniProt Gene Name: TCEB1
• UniProt Synonym Gene Names: EloC
• UniProt Entry Name: ELOC_HUMAN