Sucrose-phosphate synthase 1 Recombinant Protein | SPS1 recombinant protein
Recombinant Arabidopsis thaliana (Mouse-ear cress) Sucrose-phosphate synthase 1
Gene Names
SPS1F; ATSPS1F; F5O24.170; F5O24_170; SPS1F; sucrose phosphate synthase 1F
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sucrose-phosphate synthase 1; N/A; Recombinant Arabidopsis thaliana (Mouse-ear cress) Sucrose-phosphate synthase 1; Sucrose-phosphate synthase 1F; AtSPS1F; Sucrose-phosphate synthase 5.1; AtSPS5.1; UDP-glucose-fructose-phosphate glucosyltransferase; SPS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
768-995. Partial.
Sequence
VVIALDFDGEEDTLEATKRILDAVEKERAEGSVGFILSTSLTISEVQSFLVSGGLNPNDFDAFICNSGSDLHYTSLNNEDGPFVVDFYYHSHIEYRWGGEGLRKTLIRWASSLNEKKADNDEQIVTLAEHLSTDYCYTFTVKKPAAVPPVRELRKLLRIQALRCHVVYSQNGTRINVIPVLASRIQALRYLFVRWGIDMAKMAVFVGESGDTDYEGLLGGLHKSVVLK
Sequence Length
995
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for SPS1 recombinant protein
Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation. Required for nectar secretion.
Product Categories/Family for SPS1 recombinant protein
References
"Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana." Tabata S., Kaneko T., Nakamura Y., Kotani H., Kato T., Asamizu E., Miyajima N., Sasamoto S., Kimura T., Hosouchi T., Kawashima K., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Naruo K. Fransz P.F. Nature 408:823-826(2000)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
41.5 kDa
NCBI Official Full Name
sucrose phosphate synthase 1F
NCBI Official Symbol
SPS1F
NCBI Official Synonym Symbols
ATSPS1F; F5O24.170; F5O24_170; SPS1F; sucrose phosphate synthase 1F
NCBI Protein Information
sucrose phosphate synthase 1F
UniProt Protein Name
Sucrose-phosphate synthase 1
UniProt Gene Name
SPS1
UniProt Synonym Gene Names
SPSA1; AtSPS1F; AtSPS5.1
UniProt Entry Name
SPSA1_ARATH
Similar Products
Product Notes
The SPS1 sps1 (Catalog #AAA117329) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 768-995. Partial. The amino acid sequence is listed below: VVIALDFDGE EDTLEATKRI LDAVEKERAE GSVGFILSTS LTISEVQSFL VSGGLNPNDF DAFICNSGSD LHYTSLNNED GPFVVDFYYH SHIEYRWGGE GLRKTLIRWA SSLNEKKADN DEQIVTLAEH LSTDYCYTFT VKKPAAVPPV RELRKLLRIQ ALRCHVVYSQ NGTRINVIPV LASRIQALRY LFVRWGIDMA KMAVFVGESG DTDYEGLLGG LHKSVVLK. It is sometimes possible for the material contained within the vial of "Sucrose-phosphate synthase 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
