Sprouty-Related, EVH1 Domain-Containing Protein 1 (SPRED1) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1)
Gene Names
SPRED1; NFLS; hSpred1; spred-1; PPP1R147
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sprouty-related, EVH1 domain-containing protein 1 (SPRED1); N/A; Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1); Sprouty-related, EVH1 domain-containing protein 1; Spred-1; hSpred1; SPRED1 recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-444. Full Length of Mature Protein
Sequence
SEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFIRGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFEDLNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQDEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDETKLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIKRCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHRCGEACGCCGGKHKAAG
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for SPRED1 recombinant protein
Tyrosine kinase substrate that inhibits growth-factor-mediated activation of MAP kinase. Negatively regulates hematopoiesis of bone marrow
Product Categories/Family for SPRED1 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
70.3 kDa
NCBI Official Full Name
sprouty-related, EVH1 domain-containing protein 1
NCBI Official Synonym Full Names
sprouty-related, EVH1 domain containing 1
NCBI Official Symbol
SPRED1
NCBI Official Synonym Symbols
NFLS; hSpred1; spred-1; PPP1R147
NCBI Protein Information
sprouty-related, EVH1 domain-containing protein 1; suppressor of Ras/MAPK activation; protein phosphatase 1, regulatory subunit 147
UniProt Protein Name
Sprouty-related, EVH1 domain-containing protein 1
UniProt Gene Name
SPRED1
UniProt Synonym Gene Names
Spred-1; hSpred1
UniProt Entry Name
SPRE1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The SPRED1 spred1 (Catalog #AAA116740) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-444. Full Length of Mature Protein. The amino acid sequence is listed below: SEETATSDND NSYARVRAVV MTRDDSSGGW LPLGGSGLSS VTVFKVPHQE ENGCADFFIR GERLRDKMVV LECMLKKDLI YNKVTPTFHH WKIDDKKFGL TFQSPADARA FDRGIRRAIE DISQGCPESK NEAEGADDLQ ANEEDSSSSL VKDHLFQQET VVTSEPYRSS NIRPSPFEDL NARRVYMQSQ ANQITFGQPG LDIQSRSMEY VQRQISKECG SLKSQNRVPL KSIRHVSFQD EDEIVRINPR DILIRRYADY RHPDMWKNDL ERDDADSSIQ FSKPDSKKSD YLYSCGDETK LSSPKDSVVF KTQPSSLKIK KSKRRKEDGE RSRCVYCQER FNHEENVRGK CQDAPDPIKR CIYQVSCMLC AESMLYHCMS DSEGDFSDPC SCDTSDDKFC LRWLALVALS FIVPCMCCYV PLRMCHRCGE ACGCCGGKHK AAG. It is sometimes possible for the material contained within the vial of "Sprouty-related, EVH1 domain-containing protein 1 (SPRED1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
