SLAM family member 7 (Slamf7) Recombinant Protein | Slamf7 recombinant protein
Recombinant Mouse SLAM family member 7 (Slamf7), partial
Gene Names
Slamf7; 19A; CS1; 19A24; CRACC; 4930560D03Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
SLAM family member 7 (Slamf7); N/A; Recombinant Mouse SLAM family member 7 (Slamf7), partial; SLAM family member 7; Leukocyte cell-surface antigen; Novel Ly9; CD_antigen=; CD319; Slamf7 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-224. Partial, provide the complete extracellular domain.
Sequence
SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG
Species
Mus musculus (Mouse)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27.8 kDa
NCBI Official Full Name
SLAM family member 7
NCBI Official Synonym Full Names
SLAM family member 7
NCBI Official Symbol
Slamf7
NCBI Official Synonym Symbols
19A; CS1; 19A24; CRACC; 4930560D03Rik
NCBI Protein Information
SLAM family member 7; novel Ly9; leukocyte cell-surface antigen
UniProt Protein Name
SLAM family member 7
UniProt Gene Name
Slamf7
UniProt Entry Name
SLAF7_MOUSE
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The Slamf7 slamf7 (Catalog #AAA117746) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-224. Partial, provide the complete extracellular domain. The amino acid sequence is listed below: SGTLKKVAGA LDGSVTFTLN ITEIKVDYVV WTFNTFFLAM VKKDGVTSQS SNKERIVFPD GLYSMKLSQL KKNDSGAYRA EIYSTSSQAS LIQEYVLHVY KHLSRPKVTI DRQSNKNGTC VINLTCSTDQ DGENVTYSWK AVGQGDNQFH DGATLSIAWR SGEKDQALTC MARNPVSNSF STPVFPQKLC EDAATDLTSL RG. It is sometimes possible for the material contained within the vial of "SLAM family member 7 (Slamf7), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
