SDS-PAGE
Sugi basic protein Recombinant Protein | SBP recombinant protein
Recombinant Cryptomeria japonica (Japanese cedar) (Cupressus japonica) Sugi basic protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Sugi basic protein; N/A; Recombinant Cryptomeria japonica (Japanese cedar) (Cupressus japonica) Sugi basic protein; SBP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-374aa; Full Length of Mature Protein
Sequence
DNPIDSCWRGDSNWAQNRMKLADCAVGFGSSTMGGKGGDLYTVTNSDDDPVNPAPGTLRYGATRDRPLWIIFSGNMNIKLKMPMYIAGYKTFDGRGAQVYIGNGGPCVFIKRVSNVIIHGLHLYGCSTSVLGNVLINESFGVEPVHPQDGDALTLRTATNIWIDHNSFSNSSDGLVDVTLSSTGVTISNNLFFNHHKVMLLGHDDAYSDDKSMKVTVAFNQFGPNCGQRMPRARYGLVHVANNNYDPWTIYAIGGSSNPTILSEGNSFTAPNESYKKQVTIRIGCKTSSSCSNWVWQSTQDVFYNGAYFVSSGKYEGGNIYTKKEAFNVENGNATPQLTKNAGVLTCSLSKRC
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for SBP recombinant protein
Has pectate lyase activity.
References
Cloning and sequencing of cDNA coding for Cry j I, a major allergen of Japanese cedar pollen.Sone T., Komiyama N., Shimizu K., Kusakabe T., Morikubo K., Kino K.Biochem. Biophys. Res. Commun. 199:619-625(1994) Namba M., Kurose M., Torigoe K., Fukuda S., Kurimoto M. Isolation and characterization of cDNAs encoding major allergen Cry j 1 from Cryptomeria japonica pollen.Futamura N., Shinohara K. N-terminal amino acid sequence of a major allergen of Japanese cedar pollen (Cry j I) .Taniai M., Ando S., Usui M., Kurimoto M., Sakaguchi M., Inouye S., Matuhasi T.FEBS Lett. 239:329-332(1988) Cry j I, a major allergen of Japanese cedar pollen, has pectate lyase enzyme activity.Taniguchi Y., Ono A., Sawatani M., Nanba M., Kohno K., Usui M., Kurimoto M., Matuhasi T.Allergy 50:90-93(1995) Antigenicity of the oligosaccharide moiety of the Japanese cedar (Cryptomeria japonica) pollen allergen, Cry jI.Hijikata A., Matsumoto I., Kojima K., Ogawa H.Int. Arch. Allergy Immunol. 105:198-202(1994) Carbohydrate structures of the glycoprotein allergen Cry j I from Japanese cedar (Cryptomeria japonica) pollen.Hino K., Yamamoto S., Sano O., Taniguchi Y., Kohno K., Usui M., Fukuda S., Hanzawa H., Haruyama H., Kurimoto M.J. Biochem. 117:289-295(1995)
NCBI and Uniprot Product Information
Similar Products
Product Notes
The SBP sbp (Catalog #AAA115000) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-374aa; Full Length of Mature Protein. The amino acid sequence is listed below: DNPIDSCWRG DSNWAQNRMK LADCAVGFGS STMGGKGGDL YTVTNSDDDP VNPAPGTLRY GATRDRPLWI IFSGNMNIKL KMPMYIAGYK TFDGRGAQVY IGNGGPCVFI KRVSNVIIHG LHLYGCSTSV LGNVLINESF GVEPVHPQDG DALTLRTATN IWIDHNSFSN SSDGLVDVTL SSTGVTISNN LFFNHHKVML LGHDDAYSDD KSMKVTVAFN QFGPNCGQRM PRARYGLVHV ANNNYDPWTI YAIGGSSNPT ILSEGNSFTA PNESYKKQVT IRIGCKTSSS CSNWVWQSTQ DVFYNGAYFV SSGKYEGGNI YTKKEAFNVE NGNATPQLTK NAGVLTCSLS KRC. It is sometimes possible for the material contained within the vial of "Sugi basic protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.