Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
E Coli Or Yeast Or Baculovirus Or Mammalian Cell ptxA Recombinant Protein – Cat# AAA114956 – SDS-PAGE SDS-PAGE

Pertussis Toxin Subunit 1 (ptxA) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein

Recombinant Bordetella pertussis Pertussis toxin subunit 1

Average rating 0.0
No ratings yet
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Pertussis toxin subunit 1; N/A; Recombinant Bordetella pertussis Pertussis toxin subunit 1; Islet-activating protein S1; IAP S1; NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-); ptxA recombinant protein
Ordering

Product Overview

Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
35-269. Full Length of Mature Protein
Sequence
DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
Sequence Length
269
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

E Coli Or Yeast Or Baculovirus Or Mammalian Cell ptxA Recombinant Protein – Cat# AAA114956 – SDS-PAGE SDS-PAGE
Related Product Information for ptxA recombinant protein
S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B. pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD+ into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their membrane receptors.
References
Cloning and sequencing of the pertussis toxin genes operon structure and gene duplication.Nicosia A., Perugini M., Franzini C., Casagli M.C., Borri M.G., Antoni G., Almoni M., Neri P., Ratti G., Rappuoli R.Proc. Natl. Acad. Sci. U.S.A. 83:4631-4635(1986) Pertussis toxin gene nucleotide sequence and genetic organization.Locht C., Keith J.M.Science 232:1258-1264(1986) A unique sequence of the Bordetella pertussis toxin operon.Loosmore S.M., Cunningham J.D., Bradley W.R., Yao E.L., Dekaban G.A., Klein M.H.Nucleic Acids Res. 17:8365-8365(1989) Polymorphism in the Bordetella pertussis virulence factors P.69/pertactin and pertussis toxin in The Netherlands temporal trends and evidence for vaccine-driven evolution.Mooi F.R., van Oirschot H., Heuvelman K., van der Heide H.G., Gaastra W., Willems R.J.Infect. Immun. 66:670-675(1998) Intranasal murine model of Bordetella pertussis infection II. Sequence variation and protection induced by a tricomponent acellular vaccine.Boursaux-Eude C., Thiberge S., Carletti G., Guiso N.Vaccine 17:2651-2660(1999) Temporal trends in circulating Bordetella pertussis strains in Australia.Poynten M., McIntyre P.B., Mooi F.R., Heuvelman G.L., Gilbert G.L.Epidemiol. Infect. 132:185-193(2004) Wang Y., Zhang S., Lei D. Bordetella pertussis toxin gene encoding subunit S1.Mallya A.D., Kumar M., Reddy M.N., Seshubabu B., Deobagkar D.D., Kapre S.V. Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica.Parkhill J., Sebaihia M., Preston A., Murphy L.D., Thomson N.R., Harris D.E., Holden M.T.G., Churcher C.M., Bentley S.D., Mungall K.L., Cerdeno-Tarraga A.-M., Temple L., James K.D., Harris B., Quail M.A., Achtman M., Atkin R., Baker S., Basham D., Bason N., Cherevach I., Chillingworth T., Collins M., Cronin A., Davis P., Doggett J., Feltwell T., Goble A., Hamlin N., Hauser H., Holroyd S., Jagels K., Leather S., Moule S., Norberczak H., O'Neil S., Ormond D., Price C., Rabbinowitsch E., Rutter S., Sanders M., Saunders D., Seeger K., Sharp S., Simmonds M., Skelton J., Squares R., Squares S., Stevens K., Unwin L., Whitehead S., Barrell B.G., Maskell D.J.Nat. Genet. 35:32-40(2003) Identification of a region in the S1 subunit of pertussis toxin that is required for enzymatic activity and that contributes to the formation of a neutralizing antigenic determinant.Cieplak W., Burnette W.N., Mar V.L., Kaljot K.T., Morris C.F., Chen K.K., Sato H., Keith J.M.Proc. Natl. Acad. Sci. U.S.A. 85:4667-4671(1988) Identification of an active-site residue in subunit S1 of pertussis toxin by photocrosslinking to NAD.Cockle S.A.FEBS Lett. 249:329-332(1989) Role of tryptophan 26 in the NAD glycohydrolase reaction of the S-1 subunit of pertussis toxin.Cortina G., Barbieri J.T.J. Biol. Chem. 264:17322-17328(1989) Further analysis of the sequence of the S1 subunit of pertussis toxin.Pizza M., Bugnoli M., Puccini P., Siciliano R., Marino G., Rappuoli R.Infect. Immun. 59:1177-1179(1991) A proposed mechanism of ADP-ribosylation catalyzed by the pertussis toxin S1 subunit.Locht C., Antoine R.Biochimie 77:333-340(1995) Synergistic binding of RNA polymerase and BvgA phosphate to the pertussis toxin promoter of Bordetella pertussis.Boucher P.E., Stibitz S.J. Bacteriol. 177:6486-6491(1995) Mutations in the S1 subunit of pertussis toxin that affect secretion.Craig-Mylius K.A., Stenson T.H., Weiss A.A.Infect. Immun. 68:1276-1281(2000) Membrane localization of the S1 subunit of pertussis toxin in Bordetella pertussis and implications for pertussis toxin secretion.Farizo K.M., Fiddner S., Cheung A.M., Burns D.L.Infect. Immun. 70:1193-1201(2002) DsbA and DsbC are required for secretion of pertussis toxin by Bordetella pertussis.Stenson T.H., Weiss A.A.Infect. Immun. 70:2297-2303(2002) Temporal expression of pertussis toxin and Ptl secretion proteins by Bordetella pertussis.Rambow-Larsen A.A., Weiss A.A.J. Bacteriol. 186:43-50(2004) The crystal structure of pertussis toxin.Stein P.E., Boodhoo A., Armstrong G.D., Cockle S.A., Klein M.H., Read R.J.Structure 2:45-57(1994) Crystal structure of the pertussis toxin-ATP complex a molecular sensor.Hazes B., Boodhoo A., Cockle S.A., Read R.J.J. Mol. Biol. 258:661-671(1996)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28.2 kDa
NCBI Official Full Name
pertussis toxin subunit 1
NCBI Official Symbol
ptxA
NCBI Protein Information
pertussis toxin subunit 1
UniProt Protein Name
Pertussis toxin subunit 1
UniProt Gene Name
ptxA
UniProt Synonym Gene Names
PTX S1; IAP S1
UniProt Entry Name
TOX1_BORPE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The ptxA ptxa (Catalog #AAA114956) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 35-269. Full Length of Mature Protein. The amino acid sequence is listed below: DDPPATVYRY DSRPPEDVFQ NGFTAWGNND NVLDHLTGRS CQVGSSNSAF VSTSSSRRYT EVYLEHRMQE AVEAERAGRG TGHFIGYIYE VRADNNFYGA ASSYFEYVDT YGDNAGRILA GALATYQSEY LAHRRIPPEN IRRVTRVYHN GITGETTTTE YSNARYVSQQ TRANPNPYTS RRSVASIVGT LVRMAPVIGA CMARQAESSE AMAAWSERAG EAMVLVYYES IAYSF. It is sometimes possible for the material contained within the vial of "Pertussis toxin subunit 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.