Saposin-C (PSAP) E Coli Or Yeast Or Baculovirus Or Mammalian Cell Recombinant Protein
Reombinant Guinea pig Saposin-C (PSAP)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Saposin-C; N/A; Reombinant Guinea pig Saposin-C (PSAP); Co-beta-glucosidase; Glucosylceramidase activator; Sphingolipid activator protein 2; SAP-2; PSAP recombinant protein
Product Overview
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-81aa;Full Length
Sequence
ESVTCKACEYVVKKVMELIDNNRTEEKIIHALDSVCALLPESVSEVCQEVVDTYGDSIVALLLQEMSPELVCSELGLCMSG
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for PSAP recombinant protein
Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3. 2. 1. 45) and galactosylceramide by beta-galactosylceramidase (EC 3. 2. 1. 46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.
Product Categories/Family for PSAP recombinant protein
References
The activator protein for glucosylceramide beta-glucosidase from guinea pig liver. Improved isolation method and complete amino acid sequence.Sano A., Radin N.S., Johnson L.L., Tarr G.E.J. Biol. Chem. 263:19597-19601(1988)
NCBI and Uniprot Product Information
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The PSAP psap (Catalog #AAA114153) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-81aa;Full Length. The amino acid sequence is listed below: ESVTCKACEY VVKKVMELID NNRTEEKIIH ALDSVCALLP ESVSEVCQEV VDTYGDSIVA LLLQEMSPEL VCSELGLCMS G. It is sometimes possible for the material contained within the vial of "Saposin-C, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
