Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-YWHAE Polyclonal Antibody – Cat# AAA201668 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-YWHAE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Spleen)

14-3-3 Protein Epsilon (YWHAE) Antibody – Rabbit Polyclonal

YWHAE antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
YWHAE; MDS; HEL2; MDCR; KCIP-1; 14-3-3E
Reactivity
Dog, Guinea Pig, Mouse, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
YWHAE, Antibody; YWHAE antibody - middle region; anti-YWHAE antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Dog, Guinea Pig, Mouse, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDEN
Sequence Length
255
Applicable Applications for anti-YWHAE antibody
WB (Western Blot)
Homology
Dog: 100%; Guinea Pig: 100%; Mouse: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human YWHAE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-YWHAE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Spleen)

Rabbit Anti-YWHAE Polyclonal Antibody – Cat# AAA201668 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-YWHAE Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Spleen)

WB (Western Blot)

(Sample Type: Human NT-2, mouse brain extractsSample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary Antibody Dilution: 2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science )

Rabbit Anti-YWHAE Polyclonal Antibody – Cat# AAA201668 – WB (Western Blot) WB (Western Blot) (Sample Type: Human NT-2, mouse brain extractsSample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary Antibody Dilution: 2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science )
Related Product Information for anti-YWHAE antibody
This is a rabbit polyclonal antibody against YWHAE. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: YWHAE is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. YWHAE binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. The binding generally results in the modulation of the activity of the binding partner.This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
14-3-3 protein epsilon
NCBI Official Synonym Full Names
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein epsilon
NCBI Official Symbol
YWHAE
NCBI Official Synonym Symbols
MDS; HEL2; MDCR; KCIP-1; 14-3-3E
NCBI Protein Information
14-3-3 protein epsilon
UniProt Protein Name
14-3-3 protein epsilon
UniProt Gene Name
YWHAE
UniProt Synonym Gene Names
14-3-3E
UniProt Entry Name
1433E_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The YWHAE ywhae (Catalog #AAA201668) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YWHAE antibody - middle region reacts with Dog, Guinea Pig, Mouse, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's YWHAE can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the YWHAE ywhae for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELDTLSEESY KDSTLIMQLL RDNLTLWTSD MQGDGEEQNK EALQDVEDEN. It is sometimes possible for the material contained within the vial of "YWHAE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.