ATP-Dependent Zinc Metalloprotease YME1L1 Isoform 4 (YME1L1) Antibody – Rabbit Polyclonal
YME1L1 Antibody - C-terminal region
Gene Names
YME1L1; FTSH; MEG4; PAMP; OPA11; YME1L
Reactivity
Tested Reactivity: HumanPredicted Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
YME1L1, Antibody; YME1L1 Antibody - C-terminal region; anti-YME1L1 antibody
Product Overview
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: SDFDNATKIAKRMVTKFGMSEKLGVMTYSDTGKLSPETQSAIEQEIRILL
Sequence Length
517
Applicable Applications for anti-YME1L1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human YME1L1
Protein Size (# AA)
517 amino acids
Blocking Peptide
For anti-YME1L1 (MBS3210746) antibody is Catalog #
Replacement Item
This antibody may replace item sc-139302 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-YME1L1 antibody
This is a rabbit polyclonal antibody against FTSH. It was validated on Western Blot
Target Description: The protein encoded by this gene is the human ortholog of yeast mitochondrial AAA metalloprotease, Yme1p. It is localized in the mitochondria and can functionally complement a yme1 disruptant yeast strain. It is proposed that this gene plays a role in mitochondrial protein metabolism and could be involved in mitochondrial pathologies. Three transcript variants encoding different isoforms have been found for this gene.
Target Description: The protein encoded by this gene is the human ortholog of yeast mitochondrial AAA metalloprotease, Yme1p. It is localized in the mitochondria and can functionally complement a yme1 disruptant yeast strain. It is proposed that this gene plays a role in mitochondrial protein metabolism and could be involved in mitochondrial pathologies. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-YME1L1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
ATP-dependent zinc metalloprotease YME1L1 isoform 4
NCBI Official Synonym Full Names
YME1 like 1 ATPase
NCBI Official Symbol
YME1L1
NCBI Official Synonym Symbols
FTSH; MEG4; PAMP; OPA11; YME1L
NCBI Protein Information
ATP-dependent zinc metalloprotease YME1L1
UniProt Protein Name
ATP-dependent zinc metalloprotease YME1L1
UniProt Gene Name
YME1L1
UniProt Synonym Gene Names
FTSH1; YME1L; PAMP
UniProt Entry Name
YMEL1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Additional Details
Product Notes
The YME1L1 yme1l1 (Catalog #AAA200244) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YME1L1 Antibody - C-terminal region reacts with Tested Reactivity: Human Predicted Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's YME1L1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the YME1L1 yme1l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDFDNATKIA KRMVTKFGMS EKLGVMTYSD TGKLSPETQS AIEQEIRILL. It is sometimes possible for the material contained within the vial of "YME1L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
