Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-YBX2 Polyclonal Antibody – Cat# AAA197810 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-YBX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Y-Box-Binding Protein 2 (YBX2) Antibody – Rabbit Polyclonal

YBX2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
YBX2; DBPC; MSY2; CSDA3; CONTRIN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
YBX2, Antibody; YBX2 antibody - middle region; anti-YBX2 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPP
Sequence Length
364
Applicable Applications for anti-YBX2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human YBX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-YBX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

Rabbit Anti-YBX2 Polyclonal Antibody – Cat# AAA197810 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-YBX2 Antibody Titration: 1.0ug/mlELISA Titer: 1:12500Positive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Human kidney)

Rabbit Anti-YBX2 Polyclonal Antibody – Cat# AAA197810 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-YBX2 antibody
This is a rabbit polyclonal antibody against YBX2. It was validated on Western Blot and immunohistochemistry

Target Description: YBX2 is a member of the Y box multigene family of proteins; it contains the cold shock domain that is highly conserved among all Y box proteins and four basic/aromatic islands. By Northern blotting and immunoblotting, MSY2 appears to be a germ cell-specific protein in the testis. In the ovary, MSY2 is present exclusively in diplotene-stage and mature oocytes. MSY2 is maternally inherited in the one-cell-stage embryo but is not detected in the late two-cell-stage embryo. This loss of MSY2 is coincident with the bulk degradation of maternal mRNAs in the two-cell embryo.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
Y-box-binding protein 2
NCBI Official Synonym Full Names
Y-box binding protein 2
NCBI Official Symbol
YBX2
NCBI Official Synonym Symbols
DBPC; MSY2; CSDA3; CONTRIN
NCBI Protein Information
Y-box-binding protein 2
UniProt Protein Name
Y-box-binding protein 2
UniProt Gene Name
YBX2
UniProt Synonym Gene Names
CSDA3; MSY2; Dbpc
UniProt Entry Name
YBOX2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The YBX2 ybx2 (Catalog #AAA197810) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The YBX2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's YBX2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the YBX2 ybx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RKSRRFIPRP PSVAPPPMVA EIPSAGTGPG SKGERAEDSG QRPRRWCPPP. It is sometimes possible for the material contained within the vial of "YBX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.