Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197171_WB13.jpg WB (Western Blot) (WB Suggested Anti-XBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit XBP1 Polyclonal Antibody | anti-XBP1 antibody

XBP1 antibody - C-terminal region

Gene Names
XBP1; XBP2; TREB5; XBP-1; TREB-5
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
XBP1, Antibody; XBP1 antibody - C-terminal region; anti-XBP1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN
Sequence Length
261
Applicable Applications for anti-XBP1 antibody
WB (Western Blot)
Homology
Cow: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 92%; Rabbit: 93%; Rat: 93%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human XBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-XBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

product-image-AAA197171_WB13.jpg WB (Western Blot) (WB Suggested Anti-XBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlXBP1 is supported by BioGPS gene expression data to be expressed in MCF7)

product-image-AAA197171_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: NOP56Sample Type: MCF7Antibody Dilution: 1.0ug/mlXBP1 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-XBP1 antibody
This is a rabbit polyclonal antibody against XBP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: XBP1 is a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. XBP1 is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. This gene encodes a transcription factor that regulates MHC class II genes by binding to a promoter element referred to as an X box. This gene product is a bZIP protein, which was also identified as a cellular transcription factor that binds to an enhancer in the promoter of the T cell leukemia virus type 1 promoter. It may increase expression of viral proteins by acting as the DNA binding partner of a viral transactivator. It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum (ER), the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1 (IRE1). The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1(S), which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1(U), is constitutively expressed, and thought to function as a negative feedback regulator of XBP1(S), which shuts off transcription of target genes during the recovery phase of ER stress. A pseudogene of XBP1 has been identified and localized to chromosome 5.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
X-box-binding protein 1 isoform XBP1(U)
NCBI Official Synonym Full Names
X-box binding protein 1
NCBI Official Symbol
XBP1
NCBI Official Synonym Symbols
XBP2; TREB5; XBP-1; TREB-5
NCBI Protein Information
X-box-binding protein 1
UniProt Protein Name
X-box-binding protein 1
UniProt Gene Name
XBP1
UniProt Synonym Gene Names
TREB5; XBP2; XBP-1
UniProt Entry Name
XBP1_HUMAN

Similar Products

Product Notes

The XBP1 xbp1 (Catalog #AAA197171) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XBP1 antibody - C-terminal region reacts with Cow, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's XBP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the XBP1 xbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TQSCSSNALP QSLPAWRSSQ RSTQKDPVPY QPPFLCQWGR HQPSWKPLMN. It is sometimes possible for the material contained within the vial of "XBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.