Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-WNT7B Polyclonal Antibody – Cat# AAA198861 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: WNT7BSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Protein Wnt-7B (WNT7B) Antibody – Rabbit Polyclonal

WNT7B antibody - middle region

Average rating 0.0
No ratings yet
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
WNT7B, Antibody; WNT7B antibody - middle region; anti-WNT7B antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
Sequence Length
349
Applicable Applications for anti-WNT7B antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human WNT7B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: WNT7BSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-WNT7B Polyclonal Antibody – Cat# AAA198861 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: WNT7BSample Tissue: Human PANC1 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: WNT7BSample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Rabbit Anti-WNT7B Polyclonal Antibody – Cat# AAA198861 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: WNT7BSample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: WNT7BSample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

Rabbit Anti-WNT7B Polyclonal Antibody – Cat# AAA198861 – WB (Western Blot) WB (Western Blot) (Host: RabbitTarget Name: WNT7BSample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: WNT7BSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit Anti-WNT7B Polyclonal Antibody – Cat# AAA198861 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: WNT7BSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human brainAnti-WNT7B antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. WNT7B Antibody concentration 5 ug/ml.)

Rabbit Anti-WNT7B Polyclonal Antibody – Cat# AAA198861 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type: Human brainAnti-WNT7B antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. WNT7B Antibody concentration 5 ug/ml.)
Related Product Information for anti-WNT7B antibody
This is a rabbit polyclonal antibody against WNT7B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fat

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
protein Wnt-7b
NCBI Official Synonym Full Names
Wnt family member 7B
NCBI Official Symbol
WNT7B
NCBI Protein Information
protein Wnt-7b
UniProt Protein Name
Protein Wnt-7b
UniProt Gene Name
WNT7B

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The WNT7B wnt7b (Catalog #AAA198861) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WNT7B antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's WNT7B can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the WNT7B wnt7b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WTTLPKFREV GHLLKEKYNA AVQVEVVRAS RLRQPTFLRI KQLRSYQKPM. It is sometimes possible for the material contained within the vial of "WNT7B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.