Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-WDR5 Polyclonal Antibody – Cat# AAA198862 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-WDR5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

WD Repeat-Containing Protein 5 (WDR5) Antibody – Rabbit Polyclonal

WDR5 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
WDR5; SWD3; BIG-3; CFAP89
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Immunoprecipitation, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
WDR5, Antibody; WDR5 antibody - C-terminal region; anti-WDR5 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI
Sequence Length
334
Applicable Applications for anti-WDR5 antibody
IP (Immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human WDR5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-WDR5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit Anti-WDR5 Polyclonal Antibody – Cat# AAA198862 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-WDR5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

IP (Immunoprecipitation)

(Sample Type: Human NT2Amount and Sample Type :500 ug Human NT2 cell lysateAmount of IP Antibody :6 ugPrimary Antibody :WDR5Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :WDR5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit Anti-WDR5 Polyclonal Antibody – Cat# AAA198862 – IP (Immunoprecipitation) IP (Immunoprecipitation) (Sample Type: Human NT2Amount and Sample Type :500 ug Human NT2 cell lysateAmount of IP Antibody :6 ugPrimary Antibody :WDR5Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :WDR5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IHC (Immunohistochemistry)

(Sample Type :Human brain stem cells (NT2) Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: WDR5 Blue: DAPIGene Name :WDR5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit Anti-WDR5 Polyclonal Antibody – Cat# AAA198862 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type :Human brain stem cells (NT2) Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :Red: WDR5 Blue: DAPIGene Name :WDR5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-WDR5 antibody
This is a rabbit polyclonal antibody against WDR5. It was validated on Western Blot

Target Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
WD repeat-containing protein 5
NCBI Official Synonym Full Names
WD repeat domain 5
NCBI Official Symbol
WDR5
NCBI Official Synonym Symbols
SWD3; BIG-3; CFAP89
NCBI Protein Information
WD repeat-containing protein 5
UniProt Protein Name
WD repeat-containing protein 5
UniProt Gene Name
wdr5

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The WDR5 wdr5 (Catalog #AAA198862) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's WDR5 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the WDR5 wdr5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAGHTKAVSS VKFSPNGEWL ASSSADKLIK IWGAYDGKFE KTISGHKLGI. It is sometimes possible for the material contained within the vial of "WDR5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.