<
WB (Western Blot)
(WB Suggested Anti-VPS29 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)
Rabbit VPS29 Polyclonal Antibody | anti-VPS29 antibody
VPS29 antibody - N-terminal region
Gene Names
VPS29; DC7; DC15; PEP11
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VPS29, Antibody; VPS29 antibody - N-terminal region; anti-VPS29 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL
Sequence Length
182
Applicable Applications for anti-VPS29 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VPS29
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-VPS29 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)
WB (Western Blot)
(WB Suggested Anti-VPS29 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)
WB (Western Blot)
(Host: RabbitTarget Name: VPS29Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
WB (Western Blot)
(Host: RabbitTarget Name: VPS29Sample Tissue: Human Stomach TumorAntibody Dilution: 1.0ug/ml)
IHC (Immunohiostchemistry)
(Rabbit Anti-VPS29 antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
IHC (Immunohiostchemistry)
(Rabbit Anti-VPS29 antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
IHC (Immunohistochemistry)
(Rabbit Anti-VPS29 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
IHC (Immunohistochemistry)
(Rabbit Anti-VPS29 antibodyFormalin Fixed Paraffin Embedded Tissue: Human HeartPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)
Related Product Information for anti-VPS29 antibody
This is a rabbit polyclonal antibody against VPS29. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome
Target Description: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome
Product Categories/Family for anti-VPS29 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
vacuolar protein sorting-associated protein 29 isoform 1
NCBI Official Synonym Full Names
VPS29 retromer complex component
NCBI Official Symbol
VPS29
NCBI Official Synonym Symbols
DC7; DC15; PEP11
NCBI Protein Information
vacuolar protein sorting-associated protein 29
UniProt Protein Name
Vacuolar protein sorting-associated protein 29
UniProt Gene Name
VPS29
UniProt Synonym Gene Names
hVPS29
Similar Products
Product Notes
The VPS29 vps29 (Catalog #AAA200672) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VPS29 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's VPS29 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the VPS29 vps29 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LCTGNLCTKE SYDYLKTLAG DVHIVRGDFD ENLNYPEQKV VTVGQFKIGL. It is sometimes possible for the material contained within the vial of "VPS29, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.