Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-UBE2N Polyclonal Antibody – Cat# AAA197718 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-UBE2N Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateUBE2N is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Ubiquitin-Conjugating Enzyme E2 N (UBE2N) Antibody – Rabbit Polyclonal

UBE2N antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
UBE2N; UBC13; UbcH13; HEL-S-71; UbcH-ben; UBCHBEN; UBC13
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
UBE2N, Antibody; UBE2N antibody - middle region; anti-UBE2N antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW
Sequence Length
152
Applicable Applications for anti-UBE2N antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UBE2N
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UBE2N Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateUBE2N is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit Anti-UBE2N Polyclonal Antibody – Cat# AAA197718 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-UBE2N Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateUBE2N is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

WB (Western Blot)

(Lanes:1: 40ng HIS-UBE2D1 protein2: 40ng HIS-UBE2D2 protein3: 40ng HIS-UBE2D3 protein4: 40ng HIS-UBE2D4 protein5: 40ng HIS-UBE2E1 protein6: 40ng HIS-UBE2E2 protein7: 40ng HIS-UBE2E3 protein8: 40ng HIS-UBE2K protein9: 40ng HIS-UBE2L3 protein10: 40ng HIS-UBE2N protein11: 40ng HIS-UBE2V1 protein12: 40ng HIS-UBE2V2 protein.Primary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:50,000Gene Name:UBE2NSubmitted by:Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.)

Rabbit Anti-UBE2N Polyclonal Antibody – Cat# AAA197718 – WB (Western Blot) WB (Western Blot) (Lanes:1: 40ng HIS-UBE2D1 protein2: 40ng HIS-UBE2D2 protein3: 40ng HIS-UBE2D3 protein4: 40ng HIS-UBE2D4 protein5: 40ng HIS-UBE2E1 protein6: 40ng HIS-UBE2E2 protein7: 40ng HIS-UBE2E3 protein8: 40ng HIS-UBE2K protein9: 40ng HIS-UBE2L3 protein10: 40ng HIS-UBE2N protein11: 40ng HIS-UBE2V1 protein12: 40ng HIS-UBE2V2 protein.Primary Antibody Dilution:1:500Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:50,000Gene Name:UBE2NSubmitted by:Dr Chris Boutell. MRC-UoG Centre for Virus Research (CVR), UK.)

WB (Western Blot)

(Host: MouseTarget Name: UBE2NSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit Anti-UBE2N Polyclonal Antibody – Cat# AAA197718 – WB (Western Blot) WB (Western Blot) (Host: MouseTarget Name: UBE2NSample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :UBE2N: Red DAPI:BlueGene Name :UBE2NSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit Anti-UBE2N Polyclonal Antibody – Cat# AAA197718 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :UBE2N: Red DAPI:BlueGene Name :UBE2NSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)
Related Product Information for anti-UBE2N antibody
This is a rabbit polyclonal antibody against UBE2N. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: UBE2N encodes a member of the E2 ubiquitin-conjugating enzyme family. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. Studies in mouse suggest that this protein plays a role in DNA postreplication repair.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 N
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 N
NCBI Official Symbol
UBE2N
NCBI Official Synonym Symbols
UBC13; UbcH13; HEL-S-71; UbcH-ben; UBCHBEN; UBC13
NCBI Protein Information
ubiquitin-conjugating enzyme E2 N
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 N
UniProt Gene Name
UBE2N
UniProt Synonym Gene Names
BLU
UniProt Entry Name
UBE2N_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The UBE2N ube2n (Catalog #AAA197718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2N antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2N can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the UBE2N ube2n for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VDKLGRICLD ILKDKWSPAL QIRTVLLSIQ ALLSAPNPDD PLANDVAEQW. It is sometimes possible for the material contained within the vial of "UBE2N, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.