Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-UBE2L3 Polyclonal Antibody – Cat# AAA199211 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-UBE2L3 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that UBE2L3 is expressed in Jurkat)

Ubiquitin-Conjugating Enzyme E2 L3 Isoform 1 (UBE2L3) Antibody – Rabbit Polyclonal

UBE2L3 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
UBE2L3; E2-F1; L-UBC; UBCH7; UbcM4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
UBE2L3, Antibody; UBE2L3 antibody - C-terminal region; anti-UBE2L3 antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEK
Sequence Length
668
Applicable Applications for anti-UBE2L3 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2L3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-UBE2L3 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that UBE2L3 is expressed in Jurkat)

Rabbit Anti-UBE2L3 Polyclonal Antibody – Cat# AAA199211 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-UBE2L3 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that UBE2L3 is expressed in Jurkat)

IHC (Immunohistochemistry)

(Human Intestine)

Rabbit Anti-UBE2L3 Polyclonal Antibody – Cat# AAA199211 – IHC (Immunohistochemistry) IHC (Immunohistochemistry) (Human Intestine)
Related Product Information for anti-UBE2L3 antibody
This is a rabbit polyclonal antibody against UBE2L3. It was validated on Western Blot and immunohistochemistry

Target Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L3 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro.This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may represent one member of a small gene family that encode different but related proteins involved either directly or indirectly in transcriptional regulation. Their indirect effects on transcriptional regulation may include chromatin remodeling. It is closely related to another member of this family, a protein that has been correlated with the metastatic potential of certain carcinomas. These two proteins are so closely related that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. One of the proteins known to be a target protein for this gene product is p53. Deacteylation of p53 is correlated with a loss of growth inhibition in transformed cells supporting a connection between these gene family members and metastasis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
ubiquitin-conjugating enzyme E2 L3 isoform 1
NCBI Official Synonym Full Names
ubiquitin conjugating enzyme E2 L3
NCBI Official Symbol
UBE2L3
NCBI Official Synonym Symbols
E2-F1; L-UBC; UBCH7; UbcM4
NCBI Protein Information
ubiquitin-conjugating enzyme E2 L3
UniProt Protein Name
Ubiquitin-conjugating enzyme E2 L3
UniProt Gene Name
UBE2L3
UniProt Synonym Gene Names
UBCE7; UBCH7
UniProt Entry Name
UB2L3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The UBE2L3 ube2l3 (Catalog #AAA199211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UBE2L3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's UBE2L3 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the UBE2L3 ube2l3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TDQVIQSLIA LVNDPQPEHP LRADLAEEYS KDRKKFCKNA EEFTKKYGEK. It is sometimes possible for the material contained within the vial of "UBE2L3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.