Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
Rabbit Anti-TYR Polyclonal Antibody – Cat# AAA199410 – WB (Western Blot) WB (Western Blot) (25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

Tyrosinase (TYR) Antibody – Rabbit Polyclonal

TYR antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
TYR; ATN; CMM8; OCA1; OCA1A; OCAIA; SHEP3
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
TYR, Antibody; TYR antibody - middle region; anti-TYR antibody
Ordering

Product Overview

Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQSSMHNALHIYM
Sequence Length
529
Applicable Applications for anti-TYR antibody
WB (Western Blot)
Homology
Cow: 86%; Dog: 100%; Goat: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TYR
Protein Size (# AA)
529 amino acids
Protein Interactions
SYVN1; UBC; TYRP1; RB1;
Blocking Peptide
For anti-TYR (MBS3207289) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

Rabbit Anti-TYR Polyclonal Antibody – Cat# AAA199410 – WB (Western Blot) WB (Western Blot) (25 ug of the indicated Mouse whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.)

WB (Western Blot)

(WB Suggested Anti-TYR Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Rabbit Anti-TYR Polyclonal Antibody – Cat# AAA199410 – WB (Western Blot) WB (Western Blot) (WB Suggested Anti-TYR Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-TYR antibody
This is a rabbit polyclonal antibody against TYR. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TYR is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. It catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6-dihydroxyindole to indole-5,6 quinone.
Product Categories/Family for anti-TYR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
tyrosinase
NCBI Official Synonym Full Names
tyrosinase
NCBI Official Symbol
TYR
NCBI Official Synonym Symbols
ATN; CMM8; OCA1; OCA1A; OCAIA; SHEP3
NCBI Protein Information
tyrosinase
UniProt Protein Name
Tyrosinase
UniProt Gene Name
TYR
UniProt Entry Name
TYRO_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Additional Details

Product Notes

The TYR tyr (Catalog #AAA199410) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TYR antibody - middle region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's TYR can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the TYR tyr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CLSLTQYESG SMDKAANFSF RNTLEGFASP LTGIADASQS SMHNALHIYM. It is sometimes possible for the material contained within the vial of "TYR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.