Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198570_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: TUBB2AAntibody Dilution: 1.0ug/mlSample Type: HepG2 cell lysateTUBB2A is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit TUBB2A Polyclonal Antibody | anti-TUBB2A antibody

TUBB2A antibody - middle region

Gene Names
TUBB2A; TUBB; TUBB2; CDCBM5
Reactivity
Human, Mouse, Rat, Sheep
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
TUBB2A, Antibody; TUBB2A antibody - middle region; anti-TUBB2A antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAAC
Sequence Length
445
Applicable Applications for anti-TUBB2A antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TUBB2A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: TUBB2AAntibody Dilution: 1.0ug/mlSample Type: HepG2 cell lysateTUBB2A is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA198570_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: TUBB2AAntibody Dilution: 1.0ug/mlSample Type: HepG2 cell lysateTUBB2A is supported by BioGPS gene expression data to be expressed in HepG2)

IHC (Immunohiostchemistry)

(Small intestine, myenteric plexus)

product-image-AAA198570_IHC13.jpg IHC (Immunohiostchemistry) (Small intestine, myenteric plexus)

IHC (Immunohistochemistry)

(Rabbit Anti-TUBB2A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198570_IHC15.jpg IHC (Immunohistochemistry) (Rabbit Anti-TUBB2A AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Bone Marrow TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-TUBB2A antibody
This is a rabbit polyclonal antibody against TUBB2A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
tubulin beta-2A chain isoform 1
NCBI Official Synonym Full Names
tubulin beta 2A class IIa
NCBI Official Symbol
TUBB2A
NCBI Official Synonym Symbols
TUBB; TUBB2; CDCBM5
NCBI Protein Information
tubulin beta-2A chain
UniProt Protein Name
Tubulin beta-2A chain
UniProt Gene Name
TUBB2A
UniProt Synonym Gene Names
TUBB2
UniProt Entry Name
TBB2A_HUMAN

Similar Products

Product Notes

The TUBB2A tubb2a (Catalog #AAA198570) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUBB2A antibody - middle region reacts with Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's TUBB2A can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the TUBB2A tubb2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVNMVPFPRL HFFMPGFAPL TSRGSQQYRA LTVPELTQQM FDSKNMMAAC. It is sometimes possible for the material contained within the vial of "TUBB2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.